KEGG   Gossypium hirsutum (upland cotton): 107945461Help
Entry
107945461         CDS       T04793                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP65-like
  KO
K10598  peptidyl-prolyl cis-trans isomerase-like 2 [EC:5.2.1.8]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107945461
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ghi03041]
    107945461
   03110 Chaperones and folding catalysts [BR:ghi03110]
    107945461
   04121 Ubiquitin system [BR:ghi04121]
    107945461
Enzymes [BR:ghi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     107945461
Spliceosome [BR:ghi03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    107945461
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    107945461
Chaperones and folding catalysts [BR:ghi03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    107945461
Ubiquitin system [BR:ghi04121]
 Ubiquitin ligases (E3)
  U-box type E3
   107945461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase Rtf2 U-box zf-NOSIP zf-Nse
Motif
Other DBs
NCBI-GeneID: 107945461
NCBI-ProteinID: XP_016734967
UniProt: A0A1U8N777
Position
5
AA seq 596 aa AA seqDB search
MGKKQHSKDRMFITKTEWATEWGGAKSKENRTPFKRLPFYCCALTFTPFELPVCTKDGSV
FDLMNIVPYIRKYGKHPVTGAPLKQEDLINLTFHKNSEGEYHCPVLNKVFTEYTHIVAVK
TSGNVFCYEAIKELNIKTKNWKELLTDEPFTKEDIITIQNPNALDSKVTLDFDHVKNSLK
VDDEELRKMSSDPTYNINVAGDIKQMLAELGTDKAKQAALLGGGGTRAQNERAAALAAIL
AARSRIKEDSKSDANGESKNQPAFSIVDAASASVHGRSAAAAKAASSDKTAARIAMHMAG
ERAPVNAKMVKSRYTTGAASRSFTSTSYDPVTKNEFEYVKVEKNPKKKGYVQLHTTHGDL
NIELHCDITPRTCENFITLCDRGYYNGVAFHRNIRNFMIQGGDPTGTGRGGESIWGKPFN
DELNSKLLHSGRGVVSMANSGPHTNGSQFFILYKSANHLNFKHTVFGGVVGGLTTLSAME
KVPVDDNDKPLEEIKIISVTVFVNPYLEPDEEEEKEKSNGDKAAEDEDNDKIGSWYSNPG
TGTAESGAVGSGGVGKYLKARNTQSESATADTNITAISVTKKRKATPGEFKDFSAW
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaaacagcacagcaaagatcgaatgttcataacgaagacggagtgggctacc
gagtggggcggcgctaaatccaaagaaaatcgtacccctttcaaacgccttcccttctat
tgctgcgcccttacattcacgcccttcgagttgcctgtatgcacgaaggatggcagcgtc
ttcgatttaatgaatatagttccctatattagaaagtatgggaagcatccggttactggg
gctccattgaagcaggaggatcttatcaatcttactttccacaagaactctgaaggggag
tatcattgccctgtgctgaacaaagtttttactgagtacacacacatagttgcggtgaag
acttcaggaaatgttttctgttatgaggcaattaaagaattaaacatcaagaccaaaaat
tggaaagagcttcttacagatgaacctttcactaaggaagatataattacaattcaaaat
cctaatgcacttgacagtaaggttaccctggattttgatcatgtaaaaaatagtttgaag
gtcgatgatgaagaactaaggaaaatgagttcagatccaacttataacattaatgtcgct
ggggatatcaagcagatgctagcagagcttggaactgacaaagcaaagcaagctgctctg
cttggaggtggtgggaccagggctcaaaatgagagggctgctgctcttgctgccatttta
gctgccaggtctcgcattaaagaggattccaagtcagatgcaaatggggagagtaaaaat
caacctgcgtttagtattgtagatgctgcatctgcttcagtacatggaagaagtgctgct
gcagcaaaagctgcatcaagtgataaaactgctgctcgaattgctatgcacatggctgga
gagagggcacctgtgaatgctaagatggtgaagagccgttatacaactggtgctgcttca
cgatcctttacttctacctcctatgatcctgttaccaaaaatgaatttgagtatgttaaa
gttgagaaaaatcctaaaaagaaaggttacgttcagctgcatacaacacatggtgatttg
aacattgagctgcactgtgatattactccaaggacatgtgagaacttcatcactctttgt
gatcgaggctattacaatggagtggccttccatagaaacattcggaatttcatgattcaa
ggtggtgatccaactggtactgggagagggggtgaatccatatgggggaagcctttcaat
gatgaacttaactctaagttgcttcactcaggaagaggtgttgttagtatggccaacagt
ggccctcacacaaatggttcgcagtttttcattctatacaaatctgcaaatcatttaaac
ttcaaacatactgtatttggtggagttgttggtggcttgacgacactgtcagctatggag
aaggttcctgtggatgacaatgacaaacctctggaagagattaaaataattagtgtcaca
gtatttgtaaatccgtacttggaacctgatgaagaggaagagaaagagaagagcaatggt
gacaaggcagctgaggatgaagataatgataagattgggtcgtggtatagcaatccagga
acaggaacagcagaatccggagctgttggtagtggtggtgttggaaagtacttaaaggct
aggaacacccaaagtgagtctgctactgctgataccaatataacagcaatttctgtaacg
aagaaaaggaaagccactcctggagaatttaaagatttttctgcttggtga

DBGET integrated database retrieval system