KEGG   Gossypium hirsutum (upland cotton): 107947026Help
Entry
107947026         CDS       T04793                                 

Definition
(RefSeq) probable glutathione peroxidase 8
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00480  Glutathione metabolism
ghi00590  Arachidonic acid metabolism
ghi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107947026
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107947026
Enzymes [BR:ghi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107947026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin YfkB
Motif
Other DBs
NCBI-GeneID: 107947026
NCBI-ProteinID: XP_016737049
UniProt: A0A1U8NGW0
Position
5
AA seq 168 aa AA seqDB search
MTTLTPNNPDSVYAFTVKDAEGNDVDLNIYQGKVMLIVNVASKCGMTNSNYTELNQLYEK
YKDQGLEILAFPCNQFGEEEPGSNVEISEFVCTCFRSEFPIFDKIEVNGDNASPLYKYLK
LGKWGIFGDDIQWNFAKFLVSKDGQVVHRYYPTTSPLSLEYDIKKLLE
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccctaactccaaataacccagactccgtctatgcttttactgttaaggatgct
gagggaaacgatgtggatctcaatatttaccaaggaaaagtgatgttgattgttaatgtt
gcttccaaatgtggaatgacaaattccaactacacagaactgaaccaattatacgagaag
tataaagatcaaggcttggagattcttgcttttccgtgcaatcaatttggagaggaggaa
ccaggatcaaatgttgagatttctgaatttgtttgcacctgctttagatcggaattccct
atctttgataagattgaagtaaatggtgataatgcctctccactgtacaagtacttaaag
ttggggaaatggggaattttcggagatgatatccaatggaacttcgccaagttcttggtc
agtaaggatggtcaagttgttcatcgttattaccccaccacttctccacttagtcttgag
tatgatataaagaagttactggaataa

DBGET integrated database retrieval system