KEGG   Gossypium hirsutum (upland cotton): 107951183Help
Entry
107951183         CDS       T04793                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK8-like
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ghi01001]
    107951183
   01009 Protein phosphatases and associated proteins [BR:ghi01009]
    107951183
Enzymes [BR:ghi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107951183
Protein kinases [BR:ghi01001]
 Serine/threonine kinases: Other
  Wnk family
   107951183
Protein phosphatases and associated proteins [BR:ghi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107951183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 107951183
NCBI-ProteinID: XP_016741612
UniProt: A0A1U8NRJ7
Position
8
AA seq 517 aa AA seqDB search
MEAADGCDFAEKDPLGRYVRYDEILGKGAFKTVFKGFDEADGIEVAWNQVNIEDVLQTSE
QLERLYSEVHLLKSLKHENIMKFYNSWVDDKNNSMNMITELFTSGSLRQYRKKHKNVDLK
AIKNWSRQILRGLHYLHSHNPPIIHRDLKCDNIFVNGNNGEVKIGDLGLATVMEQPTAQS
VIGTPEFMAPELYDEEYNELVDIYSFGMCMLEMVTCEYPYNECKNPAQIYKKVSSGIKPA
SLGKVNDPQVKQFIEKCLLPASIRLPAAELLKDPFLLAETAKEVRGGPLQLPNVMPQLVN
LIQSEPHPMDIDPNCKKLTKSINTAPRSSTLELQCFTENNEFRLKGEKNDDNTISLTLRI
ADRYGRARNIHFSFYLGSDTAISITEEMVEQLDLSNEDIIAIAELIDSMILELVPYWKPS
SGSLSDVTIKTVSEQGVFSELAVVKCRDTQESLSSDISTECDGVVASDGSNNKLMGSSGY
GNGEYHTDSRTYDFGLNIGCVYNHLGHKEASDEENHC
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggctgatggttgtgattttgctgagaaagatccgttgggtcgatacgttcgg
tatgatgagatcctggggaagggagcattcaagactgttttcaagggatttgacgaagct
gatggaatagaggttgcgtggaaccaagtcaatatcgaagatgtattgcagacatctgaa
cagctggaaagattatattcggaggttcaccttttgaagtcattgaaacatgaaaatatt
atgaagttctacaattcctgggtggatgataagaacaattccatgaacatgataacagag
ttgtttacttctggaagtttgaggcaataccgtaagaagcataaaaatgttgatttgaaa
gccatcaagaactggtcacggcagatccttagaggtttacactatctgcatagtcacaat
cctccaatcattcacagagatttaaaatgtgataatatatttgtaaatggaaacaatgga
gaagtcaagatcggagatctcgggttggcaaccgtcatggagcaacccactgctcaaagt
gtaattggaacacctgaattcatggctccggagctttatgatgaggagtataatgagctt
gtcgacatttattcttttggtatgtgcatgttggagatggttacttgtgaatatccatat
aatgaatgcaaaaatcctgcacaaatatataagaaagtttcctctggtattaaacctgct
tcccttggcaaagtgaatgatccccaagttaagcagtttattgagaaatgtcttcttcca
gcatctattagattgccagctgcggagctcttgaaagatccattccttttggctgaaact
gccaaggaagttcgcggtggtccactgcagttaccaaatgttatgccccaattagtaaat
ttgatccagtctgaacctcatccaatggacatagatcctaactgcaaaaagcttacgaaa
agcatcaatacagctcctcggtcctcaactcttgagctacaatgtttcacagagaataac
gaattcaggttaaaaggggagaaaaatgacgataatacaatttcattgaccttgcgtatt
gccgatcgatatggtcgagcaaggaatatccatttttcattttatctaggttccgatact
gctatttcaatcactgaggagatggtcgaacaacttgatttgtcaaatgaagatataata
gccattgcagagttgattgacagcatgatcttggagcttgtaccctactggaaaccttca
tctggaagccttagtgatgtcactattaaaacagtcagcgagcaaggagttttctcagag
ttggctgttgtgaaatgtcgagacacccaagaatctctcagttccgatatatcaaccgaa
tgtgacggagtggtagcttcagatggaagtaataacaagctaatgggatcttctggttac
ggtaatggtgagtaccatactgattcaagaacatatgattttggtttaaatattggatgt
gtttataatcatcttggacataaagaagcgagcgacgaggaaaaccattgctaa

DBGET integrated database retrieval system