KEGG   Gossypium hirsutum (upland cotton): 107954530Help
Entry
107954530         CDS       T04793                                 

Definition
(RefSeq) mitogen-activated protein kinase homolog MMK2-like
  KO
K20600  mitogen-activated protein kinase 4 [EC:2.7.11.24]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    107954530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ghi01001]
    107954530
Enzymes [BR:ghi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107954530
Protein kinases [BR:ghi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107954530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 107954530
NCBI-ProteinID: XP_016745603
UniProt: A0A1U8P5L5
Position
9
AA seq 374 aa AA seqDB search
MSMESSCGSGDHSIKGVPTHGGRYVLYNVYGNHFEVSRKYAPPMRPVGRGAYGIVCAALN
SETREEVAIKKIGNAFDNRIDAKRTLREIKLLRHMDHENVIAIKDIIRPPQRENFNDVYI
VYELMDTDLHQIIRSDQQLTDDHCRYFLYQILRGLKYVHSANVLHRDLKPSNLLLNANCD
LKIGDFGLARTTSETDFMTEYVVTHWYRAPELLLNCSEYTAAIDIWSVGCILGEMMTRQP
LFPGRDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFSVRFPNTSPGA
VDLLERMLIFDPHRRITVDEALCHPYLAPLHDINEEPVCPRPFSFDFEQPSFTEENIKEL
IYRESVKFNPDSFH
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatggagtcaagctgtggttcaggggatcacagcatcaaaggagtaccaactcat
ggtggacgctatgttctgtacaacgtttatggtaaccacttcgaagtttccagaaaatac
gcccctcctatgcgccccgtcggccgtggtgcttatggtattgtctgtgctgctttgaat
tcagagacacgtgaggaggttgctatcaagaaaattggtaatgcatttgacaataggatt
gatgccaaaaggacattgcgagagatcaagcttcttcgtcacatggatcatgagaatgtg
attgccatcaaagacatcatacggcctccgcagagggagaactttaatgatgtctacatt
gtttatgaactgatggacactgatcttcatcaaatcatacgatctgaccaacaattgaca
gatgatcattgtcggtactttctatatcagattttacgagggctcaagtatgtacattca
gcaaatgtattgcatcgtgatttaaaacccagcaatttgcttctgaatgctaattgcgac
cttaaaattggggattttgggcttgcaaggacgacatctgaaactgattttatgacagaa
tatgtagtcactcattggtatcgagcgccagaattacttctaaattgttctgagtacact
gctgcaattgatatttggtcggtaggttgcatacttggtgaaatgatgaccaggcaaccc
ctcttccctggaagagactatgtgcatcagttgaggcttatcacagagcttataggttca
cctgatgattccagccttgggttccttcgaagtgacaatgccagaagatatgttagacag
cttccacaatatccaaggcaaaatttttctgttagatttcctaacacgtcacctggtgct
gttgatttgctagagaggatgcttatctttgatccgcataggcgcattacagttgatgaa
gctctatgtcacccatacttggcacctcttcatgacatcaatgaggagcctgtgtgccca
aggcctttcagttttgattttgagcagccatcttttaccgaagaaaatatcaaggagctc
atctatagagaatctgtaaaattcaatccagattcatttcattga

DBGET integrated database retrieval system