KEGG   Gossypium hirsutum (upland cotton): 107954794Help
Entry
107954794         CDS       T04793                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00630  Glyoxylate and dicarboxylate metabolism
ghi00710  Carbon fixation in photosynthetic organisms
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
ghi01200  Carbon metabolism
Module
ghi_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ghi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
ghi_M00532  Photorespiration
ghi_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    107954794
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107954794
Enzymes [BR:ghi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     107954794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 107954794
NCBI-ProteinID: XP_016745955
UniProt: A0A1U8P4D6
Position
9
AA seq 182 aa AA seqDB search
MASSMISSATIATVTRSSPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCM
QVWPPLGKKKFETLSYLPDLTPVQLAKEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTY
YDGRYWTMWKLPMFGCTDSAQVLKELEECKKEYPNAFIRIIGFDNVRQVQCISFIAYKPE
GY
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctccatgatctcatcggcaaccattgccaccgtgacccgctcctccccggca
caggccaacatggtggcccccttcaccggcctcaaatctgcctctgctttcccagtcacc
aggaaggccaacaacgacatcacttctcttgcaagcaacggtgggagagtgcaatgcatg
caggtgtggccgcctcttgggaagaagaagttcgagactctctcatacctgcccgatctt
actcccgtacagttggctaaggaagtagattaccttcttcgctctaaatggattccttgc
ttggaattcgaattagaggagggattcgtgcaccgtaagtactcgagcttacccacgtac
tacgatggacgctactggaccatgtggaaactgcccatgttcgggtgcaccgactcggct
caggtgttgaaggagcttgaggaatgcaagaaggaataccccaatgcattcattagaatc
attgggttcgacaacgttcgtcaagtgcagtgcattagtttcattgcctacaagcctgaa
ggctactaa

DBGET integrated database retrieval system