KEGG   Gossypium hirsutum (upland cotton): 107955204Help
Entry
107955204         CDS       T04793                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00010  Glycolysis / Gluconeogenesis
ghi00562  Inositol phosphate metabolism
ghi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107955204
   00562 Inositol phosphate metabolism
    107955204
Enzymes [BR:ghi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107955204
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107955204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 107955204
NCBI-ProteinID: XP_016746419
UniProt: A0A1U8P850
Position
9
AA seq 503 aa AA seqDB search
MLLTRLPDKMTLAAAVLLLLLTLVSNSRADRDFDVRHRLSTVTRYSAVKDIVDNSFQPTD
IPVGCTPIHLNLVARHGTRSPTKKRMRELEKLASHIKELLKDAKEKNLSPQKVPAWLLKW
ESPWKGKLRGGELDTKGEEELYQLGIRVRERFPDLFNEEYHPDVYPIKTTQVPWASTSAV
AFGMGLFSGNGSLGLARHRAFAVTSESRASDITLRFFDCCQTYKDFRKSHEPAVVKLKEP
IIAEITSALAKRYEFNFTRQDISSLWFLCKQETTLLDITDQACSLFSPTEVALLEWTDDL
EVFMLKGYGKSLNYRMGVPLLKDVIQSMDQALKAKEDNQAPGSYEKARLRFAHAETVVPF
SCLLGLFLEGSDFQRIQKEEPLDFPPKPPKNRSWRGSIVAPFAGNNMLVLYSCPANSSSK
YFVRALHNEHPIAMPGCGGTDFCPFEVFKESILSPHLKHDYNTLCQVNLDQPKQKPETSK
LLKLFHWLFSFGNDDIPSDRVEL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcttctaacaaggctgccggacaagatgactttggccgccgccgttttattgctcctt
ttgacgctagtttctaattcaagagctgatcgagatttcgatgttcgtcatcgcctctct
accgtaacaagatattctgcagtgaaagatattgtagacaattcctttcagcctactgat
attcctgttggatgtactcctatccacttaaatctcgtggcaagacatggaactcgttct
cctactaagaagcggatgagagagttggaaaagttggcttctcatataaaggaacttcta
aaagatgccaaagaaaagaatttgtccccacagaaagttcctgcttggttactgaaatgg
gaatccccttggaaagggaaattgaggggtggagaattagatacaaaaggagaagaggaa
ttatatcaacttggaatcagggttagggaaagatttcctgatttatttaatgaggaatac
caccctgatgtgtatccaataaagactacgcaagttccttgggcttctaccagtgctgtt
gcatttggcatggggctatttagtggcaatggaagtctaggactggcgcgtcatcgagct
tttgctgttacaagtgaaagtcgtgcaagtgacataaccctgaggttttttgattgttgt
caaacctataaggactttaggaaaagccatgagcctgctgttgttaaactgaaagaaccc
ataattgctgaaattacctctgcattggcaaagcgatatgagttcaatttcacaagacag
gatatatcttctctctggtttctttgtaaacaggaaacaaccttgttggatataactgat
caagcttgtagtcttttcagtcccactgaggtggctttgctggagtggacagatgattta
gaggtgttcatgttaaagggctatggtaaatccttaaattatcgaatgggagtgcctctg
cttaaagatgtcattcaatccatggaccaagcactcaaggctaaagaagataatcaagct
cctggcagttacgagaaggcaagattgcgttttgcacatgcagaaacagtggttcctttt
tcatgcttgcttgggcttttccttgaaggatctgatttccaacgaatacaaaaggaggag
cctttggatttccctcctaaacctcccaagaacagaagctggagaggcagcattgtggcc
ccttttgctggaaataatatgctggtcttatacagttgcccagctaattcttcaagcaaa
tacttcgtgcgagctctacacaacgagcatcccatcgcaatgcctggttgtggcggtact
gatttctgtccatttgaagttttcaaggagagcattttaagtccgcacttgaagcatgat
tacaataccctttgccaagtgaatcttgatcaaccaaagcagaagcccgaaaccagtaag
ttattgaaactgttccattggctcttttcgttcgggaatgatgatataccatctgataga
gttgaattgtag

DBGET integrated database retrieval system