KEGG   Gossypium hirsutum (upland cotton): 107956191Help
Entry
107956191         CDS       T04793                                 

Definition
(RefSeq) probable inactive receptor kinase RLK902
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ghi01001]
    107956191
Enzymes [BR:ghi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107956191
Protein kinases [BR:ghi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   107956191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 107956191
NCBI-ProteinID: XP_016747405
UniProt: A0A1U8P8E1
Position
9
AA seq 165 aa AA seqDB search
METMDIAPTKQAEVKIPTVDKTIEESDNTSNRLFGVFDLEDFLRAFTNVLRNGIFGTTYK
TTLGMGMGMGMVVAVKRLKDVAVLEKQFKEKMEAVGAMDRLNWVPIKAYYFSGNEKLLVY
DYIPMGSLPALMHGNRGAGRTPLNWETRFGIAFRAARSITYLHSK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggagacaatggacattgctcctacaaaacaggctgaggtaaaaatcccaacagttgat
aagacaattgaggagagtgataatacaagtaaccgcttatttggggtatttgatctagag
gattttttgagggcctttactaatgtattaaggaatggaatatttgggacgacctacaag
accaccttagggatggggatggggatggggatggttgtggcagtgaaaaggttaaaggat
gtggcagtgttagagaagcaattcaaagagaagatggaggctgttggagccatggatcgg
ctgaactgggtaccaataaaggcctactactttagtgggaatgagaaacttcttgtttat
gattacattccaatgggaagcttgcctgcacttatgcatggtaatagaggagctggtagg
actccattgaattgggaaacaaggtttggcattgcctttcgagctgcaagaagcatcaca
tacctccattcaaagtga

DBGET integrated database retrieval system