KEGG   Gossypium hirsutum (upland cotton): 107956385Help
Entry
107956385         CDS       T04793                                 

Definition
(RefSeq) Fanconi anemia group D2 protein homolog
  KO
K10891  fanconi anemia group D2 protein
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ghi03400]
    107956385
DNA repair and recombination proteins [BR:ghi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     107956385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 Sec3_C_2 FANCI_S2
Motif
Other DBs
NCBI-GeneID: 107956385
NCBI-ProteinID: XP_016747562
UniProt: A0A1U8P8M3
Position
9
AA seq 1520 aa AA seqDB search
MVMLRQQQQSRKRSSSSFVPSCPPPKIPKPQNDIGTAVDAVEKMVSILAEGGCTLVNPLG
PPSLPSDPYKLRRHLSRLFSSTDDRSVFLSGFSSYIQSSSNLRRVLMSSNGSNFGPARSE
SLVRHLLLVAPIQLDLQIMLLEKLPEYFDVVPGDSQTSLSLEDDVSRLIINQFRWLDFVV
DPSSFTDKLLQVLSICPLHFKKEIIGSLPEIIGDQNNKTVIDSLEQMLHEDPSVIVPVLD
SFSNLNLDDQLQEQVITIALSCIRTIDAEHMPCLLRFLLLSATHLNVRRLISQIREHLKF
VRTPHNRTMQKNKLKGKLVVDNTEASVLDALRSSLQFKSLLCQEIMKELNGLEKPRDHKV
IDMWLLILLYTNGESMRKSVEKVFKKKIVEGCIQEVMLDQCIRGNKELAQEYFLSFLSLS
EYILACKEQKARDFGIYMYTLLFEEFADTYSRQEVLGALVTHVGSAVSFEVTSALQIMAS
LASKHARELIPLSYHINGILDYLEGLTVENLYKVYEVFSHMALLARSSADCLGSSIANEL
FIIVRKQVGHPDLKYKKMGLIGTLKIVSCLGVESNVTSSSPFQVAPSISVSPICGSWLLY
GYLVVDHLIVLKDCSTLLKQNKSRNLLKIDKNFYLDTSQATVKVSFQEVDGFRKIIKLLI
ACAKVVFCRIGKHLGEFESIFLSDLDGGQLPSRIPYCGLEGELWMNLDGEMSPICLNILP
LASSSQNASLQFLPANFHLLSTVERLTNQGSLGGIDALLGCPMLLPSSKYFLEAEWQSLT
GKQKQIICLSLYYAMNWIRELLNAFCTQVDGRFECISQTSKDDIMQKLLKRMRNLVFLES
LLSHSIRMCPVTLPQLHLRVEHCGSAFINQPNHVGNKEKKNEPKMTPESTSPNKRKHKKT
SKTSAIGTDGNLHQQTLFDVLRKAGAVTSQEVPDKVSSKDMATSTSVDHNSHVFNESVLI
EVSPVSQALESQKFRFRPLLLECFSILTFSKDHDTCCSDPVAELPLYLYLIHDLQHKLDY
FASPTKQCSSRNIIAAAVTRMTLDEFLSKIRPLFQSLKSNLDSSFCILKEGEGNKTCQEH
WKFQSTAAGNPDLTNVVPSNSSISTMVFKEILNCFSKMLNLSEVQRYRSVLSDLLEAFQP
DKALDTGSLDVHPCPSPGTIEYLYLGACSFVECILDAVCSFSFILASEALFTLESAVTSF
QKVMDKLDGDDKIIQSVFHQILPLLRGRLASSAKKLLKHKWDNKNLENGWKNKGEMVQKI
LRTYLEYDESISDLLDELACTILPQVSLTTMAEDEDYGFPTLCSATFLSWYRVLFEVNLT
VLGKLVKEIVRLEKVRPGFQPVNVHTLLIRLQKNVNVVVALVSMCRTHDKVTLHAMAVKY
GGKFVDSFLKAFDFLQVHFQMHNEAILLLVKELQKATRTIQTLCSEAKGLKQTVITSKIP
ATKRSLERFLFRVKALLHSTSNGCTFWMGNLKHKDLRGQVVSSQAYVDDGIDSIDEDPEG
AVDVDPQGSVPSASENSENE
NT seq 4563 nt NT seq  +upstreamnt  +downstreamnt
atggttatgctccggcagcaacaacagtcacggaagagatcttcctcttcctttgtccct
tcttgtcctccgcccaaaatccccaaacctcaaaacgacatcggcactgccgttgatgct
gttgagaagatggtttcgatcttagctgagggcggttgtaccttggtaaacccgttaggc
ccgccctcccttccttcagatccctacaagctccgccgccacctctcccgcctcttttct
tctactgacgatcgctccgtttttctatctggtttctcttcttacattcagtcttcctcc
aatcttcgcagggttctcatgtcttcaaacggaagtaattttggtcccgctagaagtgaa
agcttagtccggcatctcttgctggttgcaccgatccaattagacctccaaattatgctc
cttgagaaacttcctgaatattttgatgtagttcctggagattcccaaacatcattgtcc
cttgaagatgatgtttctaggcttatcattaatcagtttcgatggcttgattttgttgtt
gatcctagttccttcaccgataagttattgcaagttctttccatttgtcctttacacttt
aagaaagagataattggatcattgcctgagatcattggtgatcaaaataacaagactgta
attgattcccttgagcaaatgcttcatgaggacccatctgtaattgttcctgtgctcgat
tctttttcaaatcttaatttggatgatcagttgcaagaacaggtcataaccatagcacta
tcatgcattagaacaattgatgcggagcacatgccgtgtctgcttcgatttttactgctc
tctgccacacacctaaatgtccgaagactaatctcacagatacgtgagcatttaaagttt
gttaggacaccgcataatcgcacaatgcaaaaaaataaactcaaagggaagttggttgtt
gacaacacagaggcatccgttctagatgctttgagatctagccttcaatttaagagtcta
ctctgtcaagagattatgaaggaattgaatggccttgaaaaacctcgagatcacaaagta
atcgacatgtggctgcttatactattgtacacaaacggtgagtccatgcgaaaaagcgtt
gaaaaggtgtttaagaagaaaattgttgaaggttgcattcaagaagttatgcttgatcaa
tgcattcgtgggaacaaggaactcgcacaggaatatttcctgtccttcctttctttatct
gagtatatattggcttgcaaagaacaaaaggcaagggattttggcatttacatgtatact
cttctttttgaagagtttgctgatacttattcaagacaggaagttcttggtgcactagtt
actcatgtgggctctgctgttagttttgaagttacttctgctcttcagattatggcttca
cttgcctcaaaacatgcaagggaactgattccactttcttatcatataaatggaatcttg
gactacttggagggattgactgtagaaaatctttataaggtttatgaggtcttcagccat
atggcactgctagctcgctctagtgctgactgtttgggctcttccattgcaaatgaactt
tttattattgttcggaagcaggttggccatccggatctgaagtacaaaaagatgggtcta
attggaaccttaaaaatagtttcatgtctaggggttgaaagtaatgtcacttcatcatca
ccatttcaggtagcacctagtatcagtgtatcccctatctgtggctcttggttattatat
ggctatttagttgttgatcacttgatcgtacttaaagattgcagcacattattaaagcaa
aacaaaagcagaaacctgctgaaaattgacaaaaacttttatcttgacacatcacaagct
actgtaaaagtttctttccaggaggttgatggatttaggaagataataaaactattaatt
gcatgtgcgaaagttgtcttttgcaggattggcaagcatttaggagaatttgaatctata
tttctgtctgatcttgatggtgggcagttgcctagcaggatcccatattgcggtttagaa
ggggagctatggatgaacttggacggtgaaatgtctcctatttgtctgaacattctgcca
ttggcttcttcttctcaaaatgcttctttgcaatttcttcctgctaacttccatttacta
tcaaccgttgaacggttgacgaaccaaggatctcttggtggaattgatgcattacttggc
tgtcctatgctacttccctcgtctaagtacttcttagaagctgaatggcagtctctgaca
ggaaagcagaaacagattatttgtctctctctttattatgcaatgaactggataagggaa
ctgctcaatgccttctgcacacaagtagatgggagatttgaatgcataagtcagacctca
aaggatgacataatgcagaagctattaaagcgaatgaggaacctcgtatttctcgaaagc
ttgttaagtcattccatcagaatgtgtcctgtaacactacctcagctccatcttcgagtg
gagcattgtggatcagcattcataaaccaaccaaaccatgtggggaataaagaaaagaag
aatgagcctaagatgacacctgaatccacatctccaaacaaaaggaagcataaaaagact
tcaaagacctcagcaattggtacagatggaaacctacaccagcaaacattgtttgatgtg
ttgaggaaagcaggagcagtgacaagccaagaggtaccagataaggtttcttcaaaagat
atggcaacctcaacatcagtggatcacaattctcatgtctttaatgagtcagtgcttata
gaagtttctccagtttcccaagctctggaatcacagaaatttaggttcaggcctcttcta
ttggaatgcttttccattttgactttttcaaaggaccatgacacctgttgctctgaccct
gtggctgagttgcccctatacctgtaccttattcatgatcttcaacacaaactggattac
tttgcttctccgaccaaacaatgttcctcaaggaacattattgctgctgctgttaccagg
atgacattggatgaatttcttagcaaaattagaccactctttcaaagtcttaagagtaac
ttagacagttcgttctgtattcttaaagaaggagaaggtaacaaaacttgtcaagaacac
tggaagtttcaatccactgctgctggcaacccagatttaaccaatgttgtgccatcaaat
tcttcaatttctacgatggtgtttaaggaaatacttaattgtttcagtaagatgctaaac
ctttctgaagttcaaaggtacagatcagttctttcagatctccttgaggcctttcagcct
gataaagcattagatactggttccttagatgtgcacccttgtccttcacctggtacaata
gaatatttgtatcttggtgcttgttcatttgtagagtgtatccttgatgcagtatgttct
ttctcctttattctggcatcagaggctctttttactttggaatcagctgttacatcattt
cagaaggtcatggataagttggatggagatgataaaatcatacagtcagtgtttcaccag
atccttcctttattgcgtggcagacttgcatcttctgctaagaaacttttgaagcataaa
tgggacaataaaaatcttgagaatggctggaagaacaaaggagaaatggtacaaaagata
ctgcggacttacttagaatatgatgagtcaatttctgatttgcttgatgagcttgcctgc
acaattttgccacaggtctctcttacaacaatggcagaagatgaggattatggtttccca
actctatgttctgcaactttcctctcatggtaccgtgtgctgtttgaagtgaatctcaca
gttcttggaaaattggttaaggaaattgttcgcttagagaaggttcgacctggttttcaa
cctgtaaatgttcacacacttttgatcaggttgcaaaagaatgttaatgtggttgttgca
ctagtcagcatgtgcagaacccatgacaaggtcaccctgcatgccatggcagtcaagtac
ggtgggaaattcgttgattccttccttaaagcttttgacttcttgcaggttcacttccaa
atgcataatgaagccatacttctgttggtgaaagaacttcaaaaggctacacgaactatt
cagaccttatgttctgaagccaagggcttgaaacaaacagtcatcactagcaaaatacct
gctactaaaagatctttggaacgctttttgtttcgtgtcaaggctcttctccattctacc
tctaacggatgcactttctggatgggtaatctaaaacacaaggatctgaggggacaggtg
gtgagctcccaggcatatgtagatgatggaattgacagcattgatgaagatccagaggga
gctgttgatgtggatccacaaggtagtgttccttctgctagtgaaaacagtgaaaatgaa
tga

DBGET integrated database retrieval system