KEGG   Gossypium hirsutum (upland cotton): 107957976Help
Entry
107957976         CDS       T04793                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00520  Amino sugar and nucleotide sugar metabolism
ghi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    107957976
Enzymes [BR:ghi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     107957976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 107957976
NCBI-ProteinID: XP_016749101
UniProt: G8XR16
Position
10
AA seq 436 aa AA seqDB search
MKQLHKQSSINHRRDEEILIPQTPPYSPKSLKHPRSLPRSINYLFKEQRLLFIFIGILIG
STFFILQPTLSRLGPTETHPSVPKSFSNNVVSHTQEFSVSNQNPIHGKMGRVPVGIGRRR
MRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENVVHLFGNPRFELIRHDVVEP
ILLEVDQIYHLACPASPVHYKYNPVKTIKTNVMGTLNMLGLAKRVGARFLLTSTSEVYGD
PLQHPQKETYWGNVNPIGERSCYDEGKRTAETLTMDYHRGDGVEVRIARIFNTYGPRMCL
DDGRVVSNFVAQAIRKQPMTVYGDGKQTRSFQYVSDLVDGLVALMEGEHIGPFNLGNPGE
FTMLELAEVVKDTIDPSATIEYKPNTADDPHMRKPDISKAKELLNWEPKIPLREGLPLMV
NDFRNRILNEDEGKGA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagttacacaagcaatcaagcattaaccataggcgagatgaagagatcttaata
cctcaaacacctccttactcacccaaatccttaaaacaccccagatctctccctagatcc
attaactatctcttcaaagaacaacgccttttgttcatcttcatcggcattttaatcggt
tctactttcttcatcctccaaccaactctctctcgtttaggcccaaccgagactcaccct
tcggtccccaaatctttctctaacaacgtcgtttcccacacccaagagttttccgtttcc
aatcagaatcctattcatggcaaaatgggtcgtgttcccgtcgggatcggtcgacggagg
atgaggatcgtcgtcaccggtggtgctgggtttgtcggtagtcacctcgttgataagcta
attggaagaggcgatgaagtgattgttatcgataatttcttcactgggaggaaagaaaac
gtggttcatctttttgggaatccgaggttcgaattgattcgacatgacgtcgttgaaccg
attctcttggaagtagatcagatctatcatttagcttgccctgcttcaccggttcattat
aaatataatcccgttaagaccatcaagacaaatgtgatgggtactcttaacatgttgggg
cttgcaaagagagttggggccaggtttttgcttacgagcacgagtgaggtttacggtgat
ccccttcagcatcctcagaaagaaacctattggggaaatgttaatccgatcggtgagagg
agttgctacgatgaaggaaaaaggactgctgaaaccttaaccatggattatcatcgaggt
gacggtgttgaggtgcgaattgctcgtattttcaatacttatggccctcgcatgtgcttg
gatgatggacgtgttgttagcaattttgttgctcaggccattcggaagcaaccgatgact
gtttatggtgatggaaaacaaacacgaagcttccaatatgtttctgatttggttgatgga
ctcgttgctttaatggaaggtgagcacataggaccttttaatctcggcaacccgggagaa
ttcaccatgctcgaattagcggaggtcgtcaaagacacgattgatccaagtgcaacgata
gaatataaaccaaacaccgcggacgatccacatatgaggaaaccggacatcagcaaagca
aaggagctgctgaactgggagccgaaaatacccctaagagaagggttaccccttatggtg
aacgatttccggaatcgtattttgaatgaagatgaaggaaagggagcttaa

DBGET integrated database retrieval system