KEGG   Gossypium hirsutum (upland cotton): 107958418Help
Entry
107958418         CDS       T04793                                 

Definition
(RefSeq) pyruvate decarboxylase 1
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00010  Glycolysis / Gluconeogenesis
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107958418
Enzymes [BR:ghi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     107958418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh
Motif
Other DBs
NCBI-GeneID: 107958418
NCBI-ProteinID: XP_016749669
UniProt: A0A1U8PHJ5
Position
10
AA seq 589 aa AA seqDB search
MEAGNKIGSSAHPTSLYPPVRGHASTGTLGRHLARRLVEIGVKDVFSVPGDFNLTLLDHL
IAEPELNLVGCCNELNAGYAADGYARAKGVGACVVTFTVGGLSVLNAIAGAYSENLPVIC
IVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTITCAQAVVNNLDDAHELLDTAISTAL
KESKPVYISIGCNLPGIPHPTFARDPVPFFLAPKVSNELGLEAAVEATANFLNKAVKPVL
VGGPKLRVANAKDAFVELADACGYPIAVMPSGKGLVPEHHPHFIGTYWGAVSTSFCGEIV
ESADAYVFIGPIFNDYSSVGYSLLIKKEKAIIVQPNRVTIGNGPSFGWVFMADFLSALAK
KLKKNTTAVENYRRIFVPPGMPLKHGNDEPLRVNVLFKHIQDMLSKDSAVIAETGDSWFN
CQKLHLPENCGYEFQMQYGSIGWSVGATLGYAQAAKGKRVIACIGDGSFQVTAQDISTMI
RCGQKSIIFLINNGGYTIEVEIHDGPYNVIKNWNYTAFVDAIHNGEGRCWTAKVRTEDEL
IDAIAAATGEKKDSLCFIEVFAHKDDTSKELLEWGSRVSSANSRPPNPQ
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggaagccggtaataaaatcggttcatcagctcatcccacttccttatatcctccggtc
cgcggacatgcctcgactggcaccctgggacgccacctggcaaggcggctcgtggagatc
ggtgtcaaggacgtcttctcagttcctggtgacttcaacttgaccctcttggatcatcta
atagcagaacctgagctgaacttagtcggttgctgcaacgagcttaacgccggatatgcg
gctgatggctatgcacgcgctaagggcgtgggagcctgcgtcgtgactttcactgttgga
ggcctgagtgtgcttaacgctattgccggtgcttacagtgagaatttgcctgtgatttgc
atagttggagggcctaattcgaatgattacgggaccaaccggatcttgcatcatactatt
ggcttgccagattttagtcaagaattaaggtgtttccagacgatcacctgtgcccaagca
gtggtgaacaacctggatgatgcgcatgagcttcttgatactgccatatccacagctttg
aaggaaagcaagcccgtttacattagtatcggctgtaatttgcctgggattcctcatcca
acatttgctagagatccagtgcccttctttctcgctccaaaggtaagcaatgaattagga
ttagaagcagctgtggaagctactgccaattttctgaacaaagctgtgaagcctgtcctt
gtgggtggacctaaattaagggttgcaaatgcaaaagatgcctttgtggagcttgcagat
gcctgtgggtatcccattgccgtaatgccttcgggcaaaggattggtacctgaacaccat
ccacactttattggaacatactggggtgcggttagtactagcttttgtggggaaatagtg
gaatctgctgatgcctatgtttttattggcccaatcttcaatgattatagctctgtaggc
tactctttgttgatcaagaaggagaaagcaatcatagtacaaccaaatcgtgtgacgata
ggcaatggtccttcttttggctgggttttcatggctgacttcttaagtgcattggcaaag
aaacttaagaaaaataccactgccgtggagaactatcggcgaatctttgtccctccaggc
atgcctttgaagcatgggaatgacgagcctctgagagtcaatgttctttttaagcacatt
caggatatgctaagcaaagactctgcggttattgctgaaactggagactcatggttcaat
tgtcagaagctccatcttccagagaactgcggttatgaattccagatgcagtatggatcc
attggttggtcagttggtgccacgcttggatatgctcaggcagctaaaggcaaacgtgtg
attgcttgcattggcgatggtagtttccaggtgacagctcaagatatttccacaatgatc
cgatgtggacaaaaaagcatcatatttcttatcaataatggaggctatacaattgaagtt
gagattcatgatggcccttacaatgttatcaagaactggaattacactgcctttgttgat
gccatccacaatggtgaaggcagatgctggacagccaaggtgaggaccgaggatgaactg
atagatgcaattgcggcagcaacaggagaaaagaaagattcactgtgtttcattgaagtt
tttgcacacaaagatgacaccagcaaagagttgctggaatggggatccagagtttcctct
gctaacagccggcctccaaatcctcagtag

DBGET integrated database retrieval system