KEGG   Gossypium hirsutum (upland cotton): 107961963Help
Entry
107961963         CDS       T04793                                 

Definition
(RefSeq) pyruvate, phosphate dikinase regulatory protein 1, chloroplastic-like
  KO
K20115  [pyruvate, phosphate dikinase]-phosphate phosphotransferase / [pyruvate, phosphate dikinase] kinase [EC:2.7.4.27 2.7.11.32]
Organism
ghi  Gossypium hirsutum (upland cotton)
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107961963
Enzymes [BR:ghi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.27  [pyruvate, phosphate dikinase]-phosphate phosphotransferase
     107961963
   2.7.11  Protein-serine/threonine kinases
    2.7.11.32  [pyruvate, phosphate dikinase] kinase
     107961963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinase-PPPase AAA_18
Motif
Other DBs
NCBI-GeneID: 107961963
NCBI-ProteinID: XP_016753642
UniProt: A0A1U8PR48
Position
11
AA seq 389 aa AA seqDB search
MLACPCSAFNLRATATPANPDISDPEPEPKVRKLKGSPQFNRWYRARALRSGHKLERPSH
GTGALEVNPSAQRISETLSLEPTSTANDSDREVEVTDSGKPIYMVSDGTGWTAEHSVNAA
LGQFEHCLVDRGCPVNTHLFSGIDDVERLMEIIKQAAKEGALLVYTLADPSMAESAKQAC
KLWGIPSTDILGPITEAIAAHLGVSPSGLPRGAAGRNIPLSDEYFRRIEAVEFTIKQDDG
ALPQNLSKADIVLTGVSRTGKTPLSIYLAQKGYKVANVPIVNGVALPKGLFEVDPEKVFG
LTINPLVLQTIRKARAKSLGFGDNARSNYSEMAYVKEELEFARKVFAQNPTWPVIEVTGK
AIEETAAVILRLYHDRKQKCSMPRISKRY
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcttgtccttgctccgccttcaacctccgggccacggccaccccggccaatccc
gatatttccgacccagaacccgagcccaaagttcggaaactaaaaggtagcccacagttc
aacagatggtaccgtgcacgagccttaaggtcgggccacaagcttgaacgaccgagccac
gggactggggcgcttgaggtgaacccctcagctcaacgaatcagtgagaccttgtctttg
gaacccacttcaacggcaaatgacagcgatcgtgaggtggaggtaacagactcggggaag
ccaatttatatggtatctgatggaactggatggacggcggagcattccgttaacgcagcg
ttggggcagttcgagcattgtttggtggatcgtggttgtcccgtaaatacccatctcttc
tctgggattgatgatgttgagagattgatggagattataaagcaggcagccaaggaaggt
gcattgcttgtatatactttagctgatccttccatggcagagtccgccaagcaagcttgc
aaattgtggggtataccatcgacggatatattgggtccaattacagaggctattgctgct
catttaggtgtctcaccttctggtcttccccgtggagcagctggaagaaacatccctctc
tcagatgaatactttcggcggattgaagctgttgaatttacaatcaagcaggatgatggg
gctctacctcaaaacttaagcaaggctgacattgtgctcacaggtgtttctcgtactggg
aagacgccgttatcaatttatctagcacagaaaggatataaagtagccaatgtgcctatt
gtgaatggagtggctttgccaaagggacttttcgaagtagaccctgagaaggtttttggt
ttgactattaatcccttggtcttgcaaactattaggaaagcaagggctaagagtctgggt
ttcggtgacaatgcaaggagtaactactcggagatggcctatgtgaaagaggagttggag
tttgctcgcaaggtttttgctcaaaatcctacatggccagtcatcgaagttactggtaaa
gcaattgaagaaactgctgccgttatattgaggctctaccatgaccgtaagcaaaagtgt
tcaatgccacgaatatcaaaacgttactaa

DBGET integrated database retrieval system