KEGG   Gossypium hirsutum (upland cotton): 107962949Help
Entry
107962949         CDS       T04793                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ghi  Gossypium hirsutum (upland cotton)
Pathway
ghi00260  Glycine, serine and threonine metabolism
ghi01100  Metabolic pathways
ghi01110  Biosynthesis of secondary metabolites
ghi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ghi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    107962949
Enzymes [BR:ghi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     107962949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_3 DegT_DnrJ_EryC1 Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 107962949
NCBI-ProteinID: XP_016755021
UniProt: A0A1U8PV65
Position
2
AA seq 361 aa AA seqDB search
MATRTVDLRSDTVTKPTEAMRAAMATAEVDDDVFGADPTAVTAVKLQSEVAKMMGKEAGL
FVPSGTMGNLISVLVHCDVRGSEVILGNNSHIHIYENGGIATIGGVHPRPVKNNEDGMMD
IDLIEDAIRDPRGELVYPTTRLICLENSHGNTGGRCLPVEYIDRVGELAKKHGLKLHIDG
ARIFNASVALGIPVDRLVQAADSVSVCLSKGIGAPVGSVIVGSETFITKARRLRKTLGGG
MRQVGVICAAALVALQENLVKFEGDHKNAKVLAEGLNQIKGLRVNVAAVETNIIFFDIVE
GSKISGEKLYKHLVERGVFVMLEGPSRMRIVLHHQISSSDVQYTLSCFQQAFSGLQEENG
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgagaacagttgatcttcgatctgatacagtcactaaaccgactgaagcaatg
agggctgcaatggctactgccgaagttgatgatgatgtcttcggagctgatccaaccgct
gtaactgccgttaagttacaatcagaagtggcgaagatgatgggcaaggaagccggtcta
tttgtcccgtcaggcaccatgggtaacttaattagtgttttggttcattgtgatgtaagg
ggaagtgaagtcattctcggaaacaattcccatatacatatctatgagaacggtgggata
gcgacaatcggaggtgtacatccgaggccagtgaagaacaatgaagatggaatgatggac
atcgatttgatcgaagatgccattagagacccaagaggagagcttgtgtacccgactaca
agactgatttgcctggagaattcacacgggaacaccgggggtcgatgcttacctgtggag
tacatagacagagttggtgagctagctaagaagcatggtttgaagcttcacatcgatggg
gctcgtattttcaatgcatctgtggcactcggaattcctgttgataggcttgtacaagct
gctgattcagtctcggtatgtctatcgaaaggtattggtgctccggttggatcagtcatt
gttggttccgaaacctttattaccaaggctagaagacttcggaaaaccctagggggtggg
atgagacaggtcggtgtcatttgtgctgctgcgttggttgctttgcaagagaatctggta
aagtttgaaggtgatcacaagaacgcaaaggtgttagcagagggactaaatcaaattaaa
ggtctaagagtgaatgttgctgcagtggaaactaatattatatttttcgacatagtggag
ggatcaaaaatctcgggggagaaactatacaagcatttagtggaacgcggtgtatttgtg
atgcttgagggtccatccaggatgagaattgttcttcaccaccaaatttcatcaagtgat
gtgcagtacactttgtcatgctttcagcaagctttcagtggattgcaagaagaaaatggc
aactaa

DBGET integrated database retrieval system