KEGG   Gossypium hirsutum (upland cotton): 107963327Help
Entry
107963327         CDS       T04793                                 

Definition
(RefSeq) probable receptor-like serine/threonine-protein kinase At5g57670
Organism
ghi  Gossypium hirsutum (upland cotton)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Usp
Motif
Other DBs
NCBI-GeneID: 107963327
NCBI-ProteinID: XP_016755366
UniProt: A0A1U8PW67
Position
11
AA seq 561 aa AA seqDB search
MATSAPAKILVGISLDPDESKEVLSWAIRVLTHPNDEVVALHVLVGKETKKRRLITKDQE
KFRQAKAHVISVLGEFSKTCQSKQVNLEARVGFSSSVRKGLIEEAKSISADFLLLRGSKN
RSKKTSNKIKRYCLKHAPEGCSVVAIRKSRQQSSDSIPPQRKVQKLSPMTVLEALEDDSC
SARGTKVAGSSSPKVSKFKGQTCIKKHMSPYKLISSLFSCLLGKRKASLSSKGKENHLIK
CFSYEEISNATNNFHSDNIVGRGGYSEVYRGDLPDGTAIAVKRLANDNKDETKEKEFLTE
LGIIGHVCHPNTATLVGCCIENGLYLIFNFSEKGTLASALHGKTSASLDWPMRYKIALGV
ARGLHYLHKCCKHRIIHRDIKASNVLLGLDYEPQISDFGLAKWLPNKWTHHAVIPIEGTF
GYLAPEYFMHGIVDEKIDVFAFGVLLLEIITGRRPVDSSKQSLLLWAKPLMESGNITELA
DPKLKGKYDEDEMHRTVLTACYCVRQSAVWRPSMSEVLKLLMTGHDSDVQKSWRMPKFTF
DELDDYSRVFGYEVPLEEEIL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctcagctcctgctaaaatacttgttggcatctcattggatccagatgaaagc
aaggaggtattgtcatgggcaatcagagttctaacccatccaaatgacgaagtcgttgcc
ctacatgttctagttggtaaggagaccaagaagcgcagactgataactaaagaccaagaa
aagtttcgccaggcaaaagctcatgttatatctgtgcttggagaattttctaagacctgt
cagtctaagcaggtaaacttggaggcaagagtaggatttagctccagtgttagaaaaggt
ctaattgaggaagcaaaatccatctcagctgactttcttcttcttcgtggctccaaaaac
cgttcaaagaagacatcaaacaagataaaaagatactgtttgaagcatgcccctgaaggc
tgttcagtggttgcgataaggaaatctaggcagcaaagctcagattctattccccctcaa
agaaaggtgcaaaagctttcaccaatgactgttttagaagcacttgaagatgacagctgt
agcgctaggggcacaaaagtggcagggtcatcctctcctaaggtgtcaaagtttaaaggc
caaacctgcataaagaaacatatgtcaccttacaaattaatctcatcattgtttagttgt
ctacttgggaaaagaaaggctagtttatccagcaaaggaaaggagaatcatttgataaag
tgctttagctatgaggagatctcaaatgctacaaataacttccattcagataatatagtt
ggtcgaggcgggtattcagaagtgtaccgaggtgatcttcctgatggaacagccatagca
gtgaagaggttggccaatgacaacaaggatgaaaccaaggagaaagaattccttacagaa
ttgggcataattggacatgtttgccaccccaatactgcaaccttagttggctgctgcatt
gaaaatggactgtatttgattttcaacttctctgagaagggaactctggcatctgctttg
catggtaaaacaagtgcgtcactagattggcctatgagatacaagattgcccttggagtt
gctagaggtcttcattacctgcataaatgctgtaaacaccgtataatacaccgcgacata
aaagcctctaatgttcttcttgggttggattatgaaccgcagatcagtgattttggtctg
gcaaaatggcttcctaataaatggactcaccatgctgtgatcccaatagaggggacattt
gggtacctagcaccagagtatttcatgcatggaattgtggatgagaaaatagatgttttc
gcatttggggttcttctcctcgagatcattaccggtcgccggcctgtggattcatcaaag
caaagcctccttttatgggcaaagcctcttatggaatctgggaacatcactgaactagct
gacccgaaactcaaagggaaatatgacgaagatgaaatgcatagaacagtgctaacagct
tgctattgcgtgaggcaatcagcagtatggcgtccttcaatgagtgaggtcctgaagctt
ctaatgactggccacgactctgatgttcaaaaaagctggagaatgccaaagtttacattt
gatgaattggatgattactctagggttttcgggtacgaggttccattagaggaggaaatt
ttatga

DBGET integrated database retrieval system