KEGG   Grimontia hollisae: AL542_01175Help
Entry
AL542_01175       CDS       T04260                                 

Definition
(GenBank) acetate/propionate family kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
gho  Grimontia hollisae
Pathway
gho00430  Taurine and hypotaurine metabolism
gho00620  Pyruvate metabolism
gho00640  Propanoate metabolism
gho00680  Methane metabolism
gho01100  Metabolic pathways
gho01120  Microbial metabolism in diverse environments
gho01200  Carbon metabolism
Module
gho_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:gho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL542_01175
   00640 Propanoate metabolism
    AL542_01175
  09102 Energy metabolism
   00680 Methane metabolism
    AL542_01175
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AL542_01175
Enzymes [BR:gho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     AL542_01175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK
Motif
Other DBs
NCBI-ProteinID: AMG29089
Position
2:264246..265451
Genome map
AA seq 401 aa AA seqDB search
MNNSLVLVLNAGSSSLKFALIDAQTGEAILSGLGECFGLDDARISWKREGQDKQETMLEQ
GGNHHEKAVAIIVELVESMDIGDRLIAIGHRVVHGGEKFAEATLLNEDVVRDIEALSELA
PLHNPANVMGIRAAMKAFKGLPQVAVFDTAFHQTMPKKAFTGAIANELYKEYGIRRYGFH
GTSHFYVTREAAKQLGKNIEETNFISVHLGNGASVCAVRNGKSVDTSMGFTPLAGLMMGT
RSGDLDPGIIEFLLKKGWSQERVFETLNKKSGFLGVSGLTSDARGILEAMDNGHEGAKLA
FEVFTYRVAKYIGSYMIPLDKLDAIIFTGGIGENSLPIRREILKNLKLLGFVEDEAGNEA
ARFGKGGIIGKSDLLGAVAMVVPTNEEFVIVSQAMELVKNL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaacaattcactcgtacttgtccttaacgcaggcagttcctctcttaaattcgcattg
atagatgcacaaaccggcgaagcaatcctttccggtttaggtgaatgcttcggtcttgat
gatgcgcgtattagctggaaacgcgaaggtcaggacaagcaagaaaccatgcttgagcaa
ggtggcaatcatcacgagaaagcggttgcgattatcgttgagttagtcgagagcatggat
atcggcgatcgcctgatcgcgattggtcaccgtgtggtacatggcggtgagaagtttgcc
gaggcaaccctgctcaatgaagacgtggttcgtgatattgaagcgctgagcgagttggcg
ccactgcacaacccggcaaacgtcatgggtatccgcgctgcaatgaaagcctttaaaggg
ctgccacaagttgcggtatttgacaccgcattccaccaaactatgcctaaaaaagcgttt
accggtgctatcgccaacgagctttataaagaatacggtattcgccgatacggcttccac
ggtaccagtcacttctacgttactcgtgaagcggctaaacagttgggcaagaatattgaa
gaaacaaacttcatttcggtccacctggggaacggcgcatcagtgtgtgcggttcgcaat
ggcaagtctgttgatacttccatgggctttacaccactggctggcttgatgatgggcaca
cgctccggtgaccttgaccccggcatcattgaattcctactgaaaaaaggctggagtcag
gagcgtgtattcgaaaccctgaacaagaaatccggtttccttggtgtatcgggtctgacc
tcagatgcgcgcggtattctggaagcgatggataacggccacgaaggtgcgaagctggcg
tttgaagtctttacttaccgtgtggcgaagtacatcggttcttacatgatcccgctggac
aagctggatgcaattatctttaccggtggcatcggtgaaaactcactgccaatccgtcgc
gagatcctgaaaaacctcaaactgcttggttttgtggaagatgaagcgggtaacgaagct
gcgcgttttggtaaaggcggcattattggtaaatcagatctgctgggcgcagtggcgatg
gttgtgccaaccaacgaagagttcgttatcgtatcgcaggcgatggaactggttaagaac
ctgtag

DBGET integrated database retrieval system