KEGG   Grimontia hollisae: AL542_06220Help
Entry
AL542_06220       CDS       T04260                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gho  Grimontia hollisae
Pathway
gho00071  Fatty acid degradation
gho00072  Synthesis and degradation of ketone bodies
gho00280  Valine, leucine and isoleucine degradation
gho00310  Lysine degradation
gho00362  Benzoate degradation
gho00380  Tryptophan metabolism
gho00620  Pyruvate metabolism
gho00630  Glyoxylate and dicarboxylate metabolism
gho00640  Propanoate metabolism
gho00650  Butanoate metabolism
gho00900  Terpenoid backbone biosynthesis
gho01100  Metabolic pathways
gho01110  Biosynthesis of secondary metabolites
gho01120  Microbial metabolism in diverse environments
gho01130  Biosynthesis of antibiotics
gho01200  Carbon metabolism
gho01212  Fatty acid metabolism
gho02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL542_06220
   00630 Glyoxylate and dicarboxylate metabolism
    AL542_06220
   00640 Propanoate metabolism
    AL542_06220
   00650 Butanoate metabolism
    AL542_06220
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AL542_06220
   00072 Synthesis and degradation of ketone bodies
    AL542_06220
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AL542_06220
   00310 Lysine degradation
    AL542_06220
   00380 Tryptophan metabolism
    AL542_06220
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AL542_06220
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AL542_06220
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AL542_06220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gho04147]
    AL542_06220
Enzymes [BR:gho01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AL542_06220
Exosome [BR:gho04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AL542_06220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMG30037
Position
1:580158..581369
Genome map
AA seq 403 aa AA seqDB search
MEKVFIVAAKRTAIGAFTGSLKDVPAGQLAAAAIKGALEAGNVAPETVNEVILGNVVSAG
QGMGIGRQAAIFAGLPESVPAYAINMVCGSGMKAVMDAVSHIRCGDANVVVAAGVENMSQ
IPFAASGSLRGGQKMGDIGLKDLLINDGLTDVYNQYHMGVTAENVAKQVGLSREQQDAYA
QQSQQKAVAAVEAGRFKDEIVPVEVKQRRQTVVFDTDEYPKADCTQEGLAKLRPAFDREG
TVTAGNASGLNDGASAVVVASEAAVQRLGLKPLAEITSYAQVGLDPKIMGLGPVGAVTQA
LKKAEISISDVDLFELNEAFAAQALGVVHQLADTHHVSADSILQKANVNGGAIALGHPLG
ASGNRILVSLIHELKKREGTVGVASLCIGGGMGTAVVVKRVDS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtgtttattgtcgcggcgaaacgtaccgcgatcggtgcatttaccggttct
ctcaaagatgtacccgcaggacaactggccgcagctgccataaaaggggcactggaagca
ggaaatgtcgcaccggaaactgttaatgaagtcattctcggtaacgtcgtcagcgcaggc
caaggtatgggaattggtcgccaggctgcgatctttgccggtcttcctgaatcggtaccg
gcttatgcgatcaacatggtttgcggtagcggtatgaaagcggtcatggacgccgtttca
cacatccgttgtggcgatgccaacgtggtggttgctgccggtgttgagaacatgtcacaa
atcccgtttgctgcgtcaggttcactgcgcggcggacaaaagatgggcgacataggcctt
aaagatctgttgatcaacgatggcctgacggacgtctacaaccaatatcacatgggtgtc
actgcggaaaacgttgccaagcaagtcggcctgagccgtgaacaacaggacgcatacgca
caacaaagccaacaaaaagccgttgctgcagttgaagctggccgtttcaaagacgaaatc
gtgccggtagaggtcaagcaacgtcgccagaccgtggtttttgataccgacgaatacccc
aaagcagattgtacgcaagaaggtctggcaaaacttcgtccagcctttgaccgcgaagga
acagtgactgccggtaacgcatcgggcctgaatgatggagcaagtgcagtagtggttgcc
tcagaggctgccgttcaacggctaggccttaaaccattggcagaaatcaccagttatgcg
caagttggactagatcccaaaatcatgggcttaggcccagtaggtgcagtaacacaagcc
ctgaaaaaagcagagatttctatttctgacgtggatctgtttgagcttaacgaagctttt
gccgcccaggcgttgggtgttgtccaccaattggcagacacacaccatgtgagcgctgac
agcattttgcaaaaagcgaatgtcaatggtggcgcaatcgctttgggtcaccctcttggc
gcatcaggtaaccgtattctggtctccctgatccacgaactgaaaaaacgcgaaggcaca
gtgggtgtcgcttcgctttgcattggcggcggcatgggtacggcagtcgtcgtgaaacgt
gttgatagctaa

DBGET integrated database retrieval system