KEGG   Grimontia hollisae: AL542_06685Help
Entry
AL542_06685       CDS       T04260                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
gho  Grimontia hollisae
Pathway
gho00620  Pyruvate metabolism
gho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL542_06685 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gho02000]
    AL542_06685 (oadA)
Enzymes [BR:gho01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     AL542_06685 (oadA)
Transporters [BR:gho02000]
 Other transporters
  Primary active transporters [TC:3]
   AL542_06685 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AUW37801
Position
1:complement(689393..691174)
Genome map
AA seq 593 aa AA seqDB search
MSKPLAITDVVLRDAHQSLFATRMRLDDMLPIAAELDDVGYWSLETWGGATFDACIRFLG
EDPWVRLRELKKAMPKTPMQMLLRGQNLLGYRHYADDVVEKFVERAHANGMDVFRIFDAM
NDVRNFEKAVKSAVDIGAHAQGTLSYTTSPYHTIDTWTDLAKRLEDLGCHSLCIKDMSGL
LKPYEAEELIKRIKASCDIPLALHCHATTGLSTATAVKAIEAGLDVLDTAISSMSQTYGH
TPTETVVAMLQGTERDTGLQLEKIEPIAAYFREVRKKYAKFEGQLKGVDSRILIAQVPGG
MLTNMEGQLKEQGAADRLDEVLEEIPRVREDLGYIPLVTPTSQIVGTQAVINVLTGERYK
SITKETAGVLKGEYGAAPATVNTALQARVLDGGEAITCRPADLLEPELHILTEELIAKSK
AEGILLAEAQVDDVLTYSLFPQVGLKFLKNRGNPDAFEPAPGTEPEVAPATAPTPASGTE
AYSVQVNGQVYDVVVGPQGELTSVTPAAAAPTAAPAPAPTAGNSEAVAAPLAGNIFKVVA
KQGHQVQEGDVLLILEAMKMETEVRATRAGIVQDVMVKEGDSVTVGSPLLSLA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagccacttgctattacagacgttgtcttgcgtgatgctcatcaatcgctgttt
gcgacccgcatgcgtctggacgatatgttaccgatagccgctgagttagatgatgtcggt
tactggtcattggaaacctggggtggggcgacgtttgacgcctgtatccgttttctgggc
gaagatccctgggttcgtttgcgtgaactgaaaaaggcaatgcccaaaaccccaatgcaa
atgttacttcgcggccaaaacctgttgggttatcgccattacgcggatgacgtggtggag
aagtttgttgagcgtgcacacgccaatggtatggatgtcttccgtatctttgatgcaatg
aatgacgtgagaaactttgaaaaggcggtgaaatcggcggtggatatcggcgctcacgca
cagggtacgctctcatataccaccagcccttaccacacgattgacacctggaccgatttg
gcgaaacgcctggaagatttgggctgtcattccctgtgtattaaagacatgtctggcctg
cttaagccttacgaagctgaagagctgatcaagcgtatcaaagcctcttgtgatatccct
cttgcgctgcattgccatgcgacgaccggtctttctacggcaactgcggtgaaggccatt
gaagcgggtctggatgtgctggacacggcgatttcatccatgagccagacgtatgggcat
accccgactgaaactgtggttgccatgctgcagggcaccgagcgtgacacagggcttcaa
cttgagaagattgaacctatcgcagcttacttccgtgaagtccgtaaaaagtacgccaaa
tttgaaggtcagctgaaaggcgtggattctcgtatcctgattgcccaggtgccgggtggc
atgctgaccaacatggaaggccaactgaaagagcaaggcgctgcggatcgcctcgatgaa
gtgctggaagaaatcccacgcgttcgcgaagatctgggatatatcccattggtcacaccg
acttcccaaatcgtgggcacccaggcggtgatcaacgtactgaccggcgagcgctataag
agcattaccaaagaaaccgcaggtgtgctgaaaggcgaatacggcgcggcaccggcgact
gtgaacacagcgcttcaggcgcgtgtgctggatggtggtgaagcgattacctgccgccct
gctgatttgcttgagccagagcttcatattctgactgaggaactgattgcaaaatccaaa
gccgaaggcattttactggctgaagcacaggttgatgatgtactgacgtattccctgttc
ccacaggttggcctcaagttcctgaagaaccgcggcaacccggatgcgtttgaacctgcg
ccgggtactgagcctgaggtcgcgccagcaactgcaccgacaccggccagcggtacagag
gcttacagcgttcaggtgaacggtcaggtgtatgatgtggttgttggcccgcaaggtgaa
ctgacatcggttacaccagcagcggctgcaccaacggcggcgcccgccccggcacctact
gccggcaattctgaggccgtagctgcccctttggcgggcaatattttcaaagtcgtcgcg
aaacaaggtcatcaggttcaggaaggtgatgtgctgcttattctggaagcgatgaagatg
gaaacagaagttcgtgcaacccgtgccgggattgtgcaggacgtgatggtgaaagagggt
gattctgtcactgttggctcaccgctgctgagtctggcgtaa

DBGET integrated database retrieval system