KEGG   Gordonia iterans: C6V83_12620Help
Entry
C6V83_12620       CDS       T05370                                 

Definition
(GenBank) RNA pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
git  Gordonia iterans
Brite
KEGG Orthology (KO) [BR:git00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:git03009]
    C6V83_12620
Enzymes [BR:git01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     C6V83_12620
Ribosome biogenesis [BR:git03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    C6V83_12620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AVM00972
UniProt: A0A2S0KH12
Position
complement(2751089..2752015)
Genome map
AA seq 308 aa AA seqDB search
MRESRAMPVPDGLDGMRVDAGLARLLGLSRTVAASLADDGDVTVDGAAVGKSHKLRAGTW
LDVTLPEPEQPLRVEPTPVEDLQVLYHDSDIIVVDKPPGVAAHPSQGWTGPTVVGALAAA
GFRISTSGAAERQGIVSRLDVGTSGVMVLAASEHAYTMLKRAFKERNVDKVYHAVVQGHL
DPPVGTVDAPIGRHPGSDWRFAVTSRGKESVTHYETIEMFAAASLLDIDLETGRTHQIRV
HFSALHHPCVGDPTYGADPKLAARLGLDRQWLHARSLSFAHPADGRRVEFTAPYPADLQH
ALDVLRES
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagtcgcgggcgatgccggtacccgacgggctcgacggcatgcgggtcgacgcc
ggtctcgcgcgactgctgggtctgtcccggaccgtcgccgcgagcctggccgacgacgga
gacgtgacggtggacggcgcggcggtgggcaagtcgcacaagctgcgggccgggacctgg
ctggacgtcaccctgcccgaacccgagcagccgctgcgggtggagccgacgccggtggag
gacctccaggtgctctatcacgactcggacatcatcgtcgtcgacaagcctccgggggtg
gctgcacatccgtcgcagggctggaccggcccgaccgtggtgggcgcgctggccgccgcg
ggtttccggatctccacgtcgggcgccgccgaacgccaaggaatcgtctcgcgactggac
gtcgggacctcgggcgtcatggtgctggccgcctccgagcacgcgtacacgatgctcaag
cgggccttcaaggagcgcaacgtcgacaaggtctatcacgcggtggtgcagggccacctg
gatccgccggtgggcaccgtcgacgcgccgatcggccgccacccgggttcggactggcgg
ttcgcggtcacctccaggggcaaggagtcggtgacccactacgagacgatcgagatgttc
gcggcggcgagcctgctcgacatcgacctggagaccggacgcacccaccagatccgcgtg
cacttctcggcgctgcaccatccgtgtgtcggggacccgacctacggcgccgatccgaag
ctcgcggcccggctgggtctggaccggcagtggctgcacgcccgatcgctctcgttcgcg
catcccgccgacggccgccgggtcgagttcaccgcgccctacccggcagatctccaacac
gcactggacgtcctccgcgagtcctga

DBGET integrated database retrieval system