KEGG   Gordonia iterans: C6V83_14675Help
Entry
C6V83_14675       CDS       T05370                                 

Definition
(GenBank) methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
git  Gordonia iterans
Brite
KEGG Orthology (KO) [BR:git00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:git03009]
    C6V83_14675
Enzymes [BR:git01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     C6V83_14675
Ribosome biogenesis [BR:git03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    C6V83_14675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: AVM01300
UniProt: A0A2S0KHZ0
Position
complement(3184778..3185596)
Genome map
AA seq 272 aa AA seqDB search
MLCCPVCADSLALDGRGLVCPQRHRFDLARQGYAPLLSGRARGLRSDTAPMVAARRRVLD
AGVFAAVAAELARHVDPDSSVIVDAGAGTGHYLAGALDAAPDASGIGIDLSKCCARSTAR
AHPRAVAVVADLWEGLPVVSRAADAVLSVFAPRNVAETARVLRPGGRWLLVTPNAGHLHQ
IREPLGMLSIGADKLARLHDDLAAGGFAVTAARPVTATAELSAPLLADLAGMGPAGFHRT
PEELSDAAEALLGGAPAARATVDITVTVAERP
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttgctgtgttgtcccgtctgcgccgattcgctggcgctcgacggtcgcggactcgtgtgc
ccgcagcggcaccggttcgacctggcccggcagggctacgccccgctgctgagcggtcgt
gcgcgcggtctccgcagcgacaccgcgccgatggtcgccgcacgacgtcgtgtgctcgac
gccggggtcttcgcggccgtcgccgccgaactcgcccgccacgtagacccggactcctcg
gtgatcgtggacgccggcgcgggtaccgggcactatctggccggggcgctcgatgccgca
ccggacgcctcgggaatcggcatcgatctctccaagtgctgtgcccggtcgacggcgcgc
gcccacccgagggccgtggccgtcgtcgccgacctgtgggaggggctgcccgtggtctcc
cgcgccgctgatgcggtgctgtcggtgttcgccccgcgcaacgtcgccgagaccgcgcgg
gtgctgcggcccggcggacgctggctgctggtgacgccgaacgccggacatctgcaccag
atccgcgaaccgctcggcatgctgagcatcggcgccgacaagctcgcccggctgcacgac
gacctggccgccggcggtttcgcggtgaccgccgcccgcccggtcacggcgaccgccgag
ctctccgcgccgctgctcgcggatctcgccggcatgggaccggccggatttcaccggacc
ccggaggagttgtccgacgcggctgaggcgttgctgggcggtgcgccggcggcgcgggcg
accgtcgacatcaccgtgacggtggccgagcggccctga

DBGET integrated database retrieval system