KEGG   Gordonia iterans: C6V83_16875Help
Entry
C6V83_16875       CDS       T05370                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
git  Gordonia iterans
Brite
KEGG Orthology (KO) [BR:git00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    C6V83_16875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF4131 UPF0767
Motif
Other DBs
NCBI-ProteinID: AVM01680
UniProt: A0A2S0KJ24
Position
3739833..3741050
Genome map
AA seq 405 aa AA seqDB search
MLILVLLIVTALGFDFTNGFHDTGNAMATSIATGALKPKTAVTIAAVLNLVGAFLSVEVA
TTVAQGILNFPSDAGELSTQVGGAEVALTIISAGLVGAILWNILTWLLGLPSSSSHALFG
GLIGSGLAALGTSGVNWSGIVGKVIVPALLAPVIACIVASVGTMLIYAITKKISETRKEQ
GFRHGQIASASLVSLAHGTGDAQKTMGVIALGLIVTGHLDPDVAEQGLPLWVIASCAIAI
ALGTYLGGWRIIRTLGKGLVEISAPQGMAAEASSAAIILTSSAAGMALSTTHVATGSILG
SGLGRKGADVRWAVAGRMAVAWLTTLPAAAVVGAISYLIARGIGGAAGAVTIFLILALAS
LYMWWRAQQQKVDSSNVNADWDESTNSPVPAELRVDLDVEPKQQA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgctgatccttgtgctgctgatcgtcacagcactcgggttcgacttcaccaacggcttc
cacgacaccgggaatgcgatggccacctccatcgccaccggtgccctgaagcccaagacc
gcggtgaccatcgccgcagtcctgaatctggtcggcgccttcctgtccgtcgaggtagca
accaccgtcgcgcaggggatcctgaacttcccctcggacgcgggcgagctcagtacgcag
gtcggcggcgccgaggtcgcactcacgatcatctccgcgggtctggtcggggcgatcctg
tggaacatcctgacctggctgctcggactgccctcgagctcgtcgcacgccctgttcggc
ggcctgatcggctccggcctggctgctctgggcaccagcggcgtcaactggagcggaatc
gtcggcaaggtgatcgtcccggccctgctcgcgccggtcatcgcctgcatcgtcgcctcg
gtcggcaccatgctcatctacgcgatcaccaagaagatctccgagacccgcaaggaacag
ggattccggcacggccagatcgccagcgcctcgctggtctccctcgcccacggcaccggc
gacgcccagaagacgatgggcgtgatcgcgctcgggctgatcgtcaccggccacctcgat
ccggacgtcgccgagcagggcctgcccctctgggtgatcgccagttgcgcgatcgccatc
gccctcggcacgtacctcggaggctggcgcatcatcaggacgctcggtaagggactggtc
gagatcagcgcaccgcagggcatggccgccgaagcctcctccgcggcgatcatcctgact
tcgtcggccgccggcatggcgctctccaccactcacgtggccaccggctcgatcctgggt
tcgggtctgggccgtaagggggcggacgtacgctgggccgtcgccggacgcatggccgtc
gcctggctgaccaccttgcccgcggccgccgtcgtcggcgcgatctcgtatctcatcgcg
cggggcatcggcggcgccgcaggcgcggtcaccatcttcctcatcctcgcgctcgcctcc
ctctacatgtggtggcgcgcccagcaacagaaggtcgactcgagcaacgtgaacgccgac
tgggacgagtcgaccaactcgccggttcccgccgagctcagggtcgacctcgacgtcgaa
cccaagcagcaggcctga

DBGET integrated database retrieval system