KEGG   Gekko japonicus: 107105422Help
Entry
107105422         CDS       T04299                                 

Gene name
DOCK6
Definition
(RefSeq) dedicator of cytokinesis 6
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107105422 (DOCK6)
Membrane trafficking [BR:gja04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    107105422 (DOCK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398
Motif
Other DBs
NCBI-GeneID: 107105422
NCBI-ProteinID: XP_015260864
Position
Un
AA seq 2136 aa AA seqDB search
MGGILLESVFSARGPRVPQPSGRSFLALALSRLISRTVAAEVRKQVSREYGNSPQLSKKH
GGLPQAVPLTEVVEPVDFEEYVSSHLSEIEPGPLPDLVEXADDLEVLHRPRDCRTLEPGV
PDDGKQDARVRDAVRIYTEDWVMVQRKYQRLSPVGGARAAERQRDRQKELPRQDFELDEA
AQERSGSQGDPDDQKRSSASLDDTPRGSWASSIFDLKNCAADSLLPSLLTRTAIEETDRR
NEEQRKENRHGEILALYPAPDEDEAVERCSVPEVPKEHFGQRILVKCLSLKFEIEIEPIF
GSLALYDVKEKKKISENFYFDLNSEPVKSLLRAHGTHPAISTLARSAVFSLTHPSPDIFL
VIKLEKVLQQGDISECCEPYMVLKETEATKNKEKLEKLRGVAEQFCARLGQYRMPFAWTA
IHLLNIVSSAGLLERETSEPEGERKGTWNERKRKAHERMSVGEETCSFSNFRPATLTVTN
FFKQEADRLSDEDLYKFLADMRRPSSVLRRLRPITALLKIDISPVPENPHYCLSPELLHV
QPYPDLRVRPTKEILEFPVREVYAPHTTYRNLLYVYPQSLNFSSRQGSVRNIAVKLQFMA
GEDPGQALPVIFGKSSCSEFVKEAYTAVVYHNKSPEFYEEFKLKIPANLTDNHHLLFIFY
HVSCQQKQSTPTETPVGYTWIPLMQHGRLRTGQFCLPVSVDKPPPSYSVLTPDVQLPGMK
WVDSHKGVFSVELVAVSSVHTQDPFLDRFFTLTHVLEEYSFPFRLKDVILTESNMEPELK
SSVGNLRVASLEPLVAFSHQVLNKLVQLMVRPPVIGGQTVNMGRAAFEAMAVMVNQIHRS
LEGSHDHHGRSHLLSSYVFYAFHLPVVEPGLADAGLPPPSGPAQSATLSRTSGRPASLNL
SRSKSISNSNPDLATSPDSPEEQAQKVNGSKGIDRSHSWVNSAYAPGGPRNVLRRNHPNS
STDLKQAAGRMPHRLSAYLESSTLAPATLMRPSTKKLLHEELALQWVVSTSAVREAAIHQ
AWFFFQLMVKSMAHHLFLCGKLEAPRKARFPSRFVDDISALVCALSAEIASRCQKDAELV
EHLNGSLAFFLNDLLSLMDRGFVFHLLRSYYKQINNRLLATQNPNTLVALRMDFIRIICS
HEHYVTLNLPCSGLSPPSSPSPSVSSATSQGSAFSSHTQDQRVANMFELSVAFRQQHFLA
GLVLMELALILEPDAEGAFSLHKKAVSALHNLLCSHDSDPRYADSAVRAQVAQLYLPLIG
IVMDALPRLCDCTEIHSQRGRLASVPADEGDGEGGTISPSVAMAIAGSPLPHSHRPSQFQ
MPSVPPRQYSMLSAEVSRTLLVCLLWVLKNADGALLHRWLADLSALQVNRLLDLLYLCVS
CFEYKGKKTLERLNSLTFKKSLDMKARLEEAILGTIGARQEMVRRSRERSPFGNQENVRW
RKNIAHWRQNSDKVDKSRDEVEREALVDGNLATEANMVVLDTLEIVVQTVILSEAKESVL
SGVLRVLLHSMACTPSAAFLQHCFATQRALVSKFPEMLFEEDTELCADLCLRLLRHCSSR
VGTIRAHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSPNFNEEHLRRSLKTIL
TYAEEDLELRDTTFAEQVQDLVFNLHMILTDTVKMKEHQEDPEMLIDLMYRIAKGYQASP
DLRLTWLKNMAAKHAERGNHAEAAQCLVHSAALVAEYLSMLEDCPYLPVGCVTFQNISSN
VLEESAVSDDVLSPDEEGICSGKSFTEQGLVGLLEQAASAFTMGGLYEAVNEVYKILTPI
HEANRDFQKLATLHGKLQDAFSKITSQRMFGTYFRVGFYGSKFGDLDEQEFVYKEPSITK
LAEISHRLEEFYAERFGDDMVEIIKDSNPVHKNKLDPNKAYIQLTYVEPFFDTYELKDRI
TYFDKNYNLRTFMFCTPFTLDGRAHGDLHEQFKRKTLLTTSHAFLXXXXPYIRTRINVIR
KEEVILIPIEVAIEDMQKKTQELAFATHQDPADAKMLQMVLQGCVGTTVNQGPLEVAQVF
LAEIPDDPKLYRHHNKLRLSFKDFTKRCEDALRKNKTLIGPDQRDYHRELERNYQRLKEA
LHPLLSRKIPQLYTPIAPYPAHRNSFSRLSLRKMEA
NT seq 6411 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggattctcttggagagcgtcttcagtgccagaggcccccgggtgccccagcct
tcggggagaagctttctggccctagccttgtctcggctgatctctcggacggtggcggcg
gaagtgaggaagcaggtgtcccgggagtacggcaactccccccagctctccaagaagcac
gggggcctcccacaggcggtgcctttgacagaagtggtggagccggtggactttgaggag
tatgtcagtagccacctgtcagagattgagcctggcccactccctgacctcgttgagncg
gctgatgatctggaggtgctccaccgcccccgggactgtcggacgctggagcctggtgtc
cccgacgatggcaagcaggatgcccgagtgcgtgacgccgtgcggatctacaccgaggac
tgggtcatggtccagaggaagtaccaaaggctgagccccgtgggcggtgcccgtgcagcg
gagaggcaaagggaccggcagaaggagctgcccaggcaagacttcgagctggacgaggcg
gcccaggagcgcagtggcagccagggggatccagacgaccagaagcgcagctcggcctcc
ttggacgacacgccccggggcagctgggcctccagcatctttgacctgaagaactgtgcg
gccgactccctgctgccttccctgctgacgcgcacggccatcgaggagacggaccgccgg
aacgaggagcagcgcaaggagaaccggcatggcgagatcctggccctctaccctgcccca
gacgaggacgaggcggtggagcgctgcagcgtcccagaagtccccaaggagcactttggc
cagcggatcctggtgaaatgtttgtctctgaagtttgagatcgagatcgaacccatcttt
gggtctctggcgctgtatgatgtgaaagagaagaaaaagatttctgagaatttttatttc
gacctcaattcggagcccgtgaagagccttctgcgggcccatggcacccacccggccatc
tccaccctggctcgctcagcggtcttttctctcactcacccgtctccagacatcttcctg
gtgatcaagctggagaaggtgcttcagcagggggacatcagtgagtgctgcgagccgtac
atggtcctgaaggagacggaggccacgaagaacaaggagaagctggagaagctgcggggg
gtggctgagcagttctgcgcacgcctggggcagtaccgcatgccctttgcctggactgcc
atccacctcctgaacatcgtcagcagtgccggcctgctcgagagggagacttcggagccg
gagggcgagcgcaagggcacctggaatgagcgcaagaggaaagcccacgagcgcatgagt
gttggggaggagacttgcagcttcagcaacttccgcccagcgacgctcacggtcaccaat
tttttcaagcaggaggccgaccgtctcagtgacgaagacttgtacaagttcctggcggat
atgaggcggccctcgtccgtcctgcggaggctccggccgatcacggccctgctcaagatc
gacatttcgcccgtgccagagaacccgcattactgcctgtctccggagctgctgcatgtc
cagccctatcctgacctccgggtgcggcccaccaaagagatcctggagttccccgtcagg
gaggtctacgcgcctcatacgacgtatcggaacctgctctacgtttatccccaaagtctg
aacttcagcagccgccaagggtccgtgcggaacatcgcagtgaagctgcagttcatggcc
ggggaggaccccgggcaggccttgccggttatctttggaaagtcaagttgcagcgagttt
gtgaaggaggcctacaccgcagtggtgtaccataacaagtcccccgagttctacgaggag
ttcaagctgaagatcccggccaacctcacggacaaccaccacctcctgtttatcttctac
cacgtgagctgtcagcagaagcagagcacacccacggagaccccggtcggctacacatgg
atccctctcatgcagcacgggcggctgcggacgggccagttctgcctccccgtgtccgtg
gacaagcctccgcccagctactccgtgctcaccccggacgtccagctgccgggcatgaag
tgggtggacagccacaaaggggtcttcagcgtggagctggtggccgtgtcctccgtccac
actcaggacccgtttctagaccggttcttcaccctgacccacgtgctggaggagtactcc
tttccgttccggctgaaagacgtgatcctgacggagagcaacatggagcctgagctgaag
tccagcgtgggcaacctccgcgtggccagcctggagcccctcgtcgccttcagccaccag
gtcctcaacaagctcgtccagctgatggtgcgcccgccggtcatcggggggcagacagtg
aacatgggccgcgcggcctttgaagccatggctgtgatggtgaaccagatccacaggagc
ctggaggggagccacgaccaccacggccgcagccacctcctgtcctcctacgtcttttac
gcctttcatctccccgtggtggaacccggcttggcagacgccggactgcccccgcccagc
ggccccgctcagtctgccactctgtcccgcacgagtgggcgtcccgccagcctcaacctc
tcccgctccaaaagcatcagcaacagcaacccagacctggccacctccccggactccccc
gaggagcaagctcagaaggtcaacggcagcaaggggatcgaccgctcgcactcctgggtc
aactcggcttacgccccggggggtccgaggaacgtgctccgcaggaaccacccgaactcc
agcacggacctgaagcaggccgcagggcgcatgcctcaccgcctctccgcctatctcgag
agctccactttggctccggccaccctgatgaggccgtcaaccaaaaagctgcttcacgaa
gagctggccctccagtgggtggtgagcaccagcgccgtgcgagaagcggccatccaccaa
gcctggttcttctttcagctgatggtgaagagcatggcccaccacctgttcctttgtggc
aagctagaggctccccgcaaggcgcgctttcccagccgttttgtcgacgacatctcagcc
ctggtgtgtgccctcagcgcggagatcgccagccgttgccagaaggatgcagaactggtg
gaacacctcaacggcagcctggccttcttcctcaacgacctgctctccctcatggaccgg
ggctttgtcttccacctcctgcgctcctactacaagcagatcaacaaccggctgctggcc
acccagaacccgaacaccctcgtggccctgaggatggacttcatccgcatcatttgcagc
cacgagcattacgtcactctgaaccttccttgcagcggcctgtccccaccctcgtcccca
tcgccttctgtctcttcggccacctctcagggctcggccttctccagtcacactcaggac
caacgagtggccaacatgtttgaactctctgtggcgttccggcagcagcacttcctggcc
gggctggtgctgatggagttggcgcttatcctggagccggatgccgagggggccttctcc
ctgcacaaaaaggctgtcagtgctctacacaacctcttgtgcagccatgactcggaccca
cgctatgcagacagtgccgtgcgggcacaagtggcccagctgtacttgccattgatcggc
attgtcatggatgccctgccccggctctgtgactgcacggagatccacagccagcggggg
cggctggcctccgtcccggcagatgaaggagatggggagggtggcaccattagcccctct
gttgccatggccattgctggctctccactgcctcactcccaccggcccagccagttccag
atgccatcagtgcctcctcgccagtacagcatgctgtccgctgaggtgagccgcacgctg
ctggtgtgtctcctctgggtcctgaagaatgccgatggcgctctgctgcatcgctggctt
gccgacctctccgccttgcaagtgaaccgcctcctggacctcctctacctctgcgtctcc
tgcttcgagtacaagggcaagaagaccttggagcgtctcaacagcctgacgttcaagaag
tctctggacatgaaagcccggctggaggaagccatcctgggcaccattggagctcgccag
gagatggttcggcgcagtcgagagcgcagcccctttggaaaccaggagaatgtccgctgg
aggaagaatatcgcccactggaggcagaactcagacaaagtggacaagtccagagacgag
gtggagcgtgaggctctggtggacgggaatttggccacagaggccaacatggtggtgctg
gacactctggagatcgtggtgcagacggtgatcttgtcggaggccaaggagagcgtcctg
agcggggtgctgcgggtgcttctccatagcatggcatgtaccccgagtgccgccttcctg
cagcactgctttgccacccagcgagccttagtcagcaagttcccagagatgctttttgag
gaggacacggagctgtgtgccgacctgtgtctgcggcttctgcggcactgcagcagccgg
gtgggcaccatccgcgcgcatgccagcgcctccctctacttgctcatgcgacagaacttt
gagatcggcaacaactttgcccgggtgaagatgcaggtcaccatgtccctctcctcgctg
gtggggacgtcgccgaatttcaacgaggagcacttgcggcgctccctgaagacgatcctg
acctacgcggaggaggacctggagctgcgggacaccacctttgccgagcaggtccaagac
ctcgtcttcaatctgcacatgatcctgacggacacagtgaagatgaaggaacaccaggag
gaccccgagatgctgatcgacctgatgtacaggatagccaagggctaccaggcgtccccg
gacctgcggctgacgtggctgaagaacatggcggcgaagcacgcggagcgcgggaaccat
gccgaggcggcccagtgcctggtgcactctgctgccctggtggccgagtacctgagcatg
ctggaggactgcccctacctgccagtcggctgcgtcactttccagaacatctcctccaac
gtgctggaagagtccgccgtctccgatgacgtcctgtcccctgacgaagagggcatctgc
tccgggaagtccttcacagagcaggggctggtggggctgctggagcaggccgcttccgcc
ttcacgatgggggggctctacgaggctgtcaacgaggtctacaaaatcctgactcccatc
cacgaggccaaccgcgacttccagaagctggccaccctgcacgggaagctgcaggacgcc
ttcagcaagatcaccagccagaggatgtttggaacgtattttcgggtcggcttctacggt
tccaagtttggggacctggatgagcaggagtttgtgtacaaggagccgtccatcaccaag
ttagcggagatctctcaccgacttgaggagttctatgccgagcgtttcggggacgacatg
gtcgagatcatcaaagactctaaccccgtgcacaagaacaagctggatcctaacaaggcg
tatatccagttgacttacgtggagccgttctttgacacctatgagctgaaggaccgcatc
acgtactttgacaagaactacaacctgcgcaccttcatgttctgcacccccttcacgctg
gacgggcgtgcgcatggcgacctccacgaacagttcaagcgcaagaccctgctcaccacc
tctcatgcctttctnnnnnnnnnnnttccctacatcaggacccgcatcaatgtcatccga
aaggaggaggtcattctgatccccattgaggtggccattgaggacatgcagaagaagacc
caggaactggcctttgccacccaccaggacccggctgatgccaagatgctgcagatggtg
ctgcagggctgcgttggcacgaccgtcaatcagggacctctggaagtggcgcaggtattt
ctggctgagatcccagatgaccccaagctgtatcggcaccacaacaagctgaggctctcc
ttcaaggacttcaccaagagatgcgaagacgcccttcgcaagaacaagaccctgattggg
ccagaccagcgtgactaccatcgagagctggagaggaattaccagcgcctgaaggaggcc
ctgcacccgctcctcagccgcaagatccctcagctgtacacccccatcgccccgtatcct
gcacacagaaactctttcagcagactgagcttgcggaagatggaagcctag

DBGET integrated database retrieval system