KEGG   Gekko japonicus: 107105558
Entry
107105558         CDS       T04299                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gja03000]
    107105558 (AHRR)
Transcription factors [BR:gja03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    107105558 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 107105558
NCBI-ProteinID: XP_015261042
Position
Un
AA seq 728 aa
MIPPGDCLYAGRKRRKPVQKQRPALGSGKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQAVQQNENHSADVTPSHTSKEVQDCFAEADRFVQTLSGFA
LVVSADGMVFYASPTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQLLSG
HNAQTEAGEELILNKTFKAQENDTMPTEFSPFLTRCFTCRIRCLLDTTSGFLTMQFQGKL
KFLFGQRKKSPSGEVLPPQLSLFCIAVPVLLPSATDMKLKSLLMKAKCRPDNAATTYTNS
KAISGQHVADFHGRNNFLEGKNNKEMMKWPANEDHWVWIQANAQVCYRDGSSDYATALQQ
APKEGDDHQKIPNSMTSLKGNRDALDPMKHHKWTTMKKEQDCIKVKFEPHADDDGEYFSP
QEFVSSNGPLFGVQHSNNPNGTWTSRNPSSSCTRGQHNENMCPNKTVRPFYSRDQQVCGL
SAACSSHWGGIQNYQPHAHSQQYTADGHSAEGTKLQCPLISPEALYSPQNTLIKTEYDSD
SENVANSYAVSPSQVWMDEKSVAKKHSSHFPSRVHLKAELEFNKQPPLCQSPKRWVYSPY
NWQRLVMHHTNNISRNGSGKGVHYKETTPLGPRNPICVDTTEGTQGTYCCDTFYNTSFID
ETEQNTQVLKTHCEFKSPSFIPAIKHEPLESPPIAGSGQNGVQATFSENVFGSQPHKIMG
CAFSRQTV
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgattccaccaggagactgtctatatgctgggaggaaaagacggaaacccgttcagaaa
cagaggcccgcacttggaagtgggaagtccaatccttccaagagacacagagaccgcctg
aatgctgaattagatcacctggccagcctcctgcctttcccaccagacatcatctccaag
ctggacaagctctccgtcttgcgtctcagcgtcagttaccttagagtcaagagcttcttc
caagccgttcagcaaaatgaaaaccactcagcagacgtaacgccctcgcatacctccaag
gaagtccaggattgctttgcagaggcagacaggtttgttcagacactaagtggttttgca
ctagtggtaagcgctgacggaatggtattttatgcgtccccaacaattgtggattatcta
ggatttcatcagactgatgtaatgcatcaaaatatatatgattacattcacgtggacgac
cggcaagatttctgtagacaactgcactgggccatgaatccgccacaactgctgtctgga
cacaatgcgcagacggaggcaggagaagaactcatccttaataaaacgtttaaagcccag
gagaatgacacgatgccaacagaattttcgccttttttgactcggtgttttacttgccga
atccgctgccttttagatactacttctggcttccttaccatgcagtttcaaggtaaacta
aaatttctctttgggcaaagaaagaaatctccctctggagaggtattacctcctcaacta
tccttattctgcatagctgtacctgttctgctgccttctgcgactgacatgaagttaaaa
agccttctcatgaaagcaaaatgcaggcctgataacgctgccacaacatatacaaactca
aaggctatttcaggacagcatgttgctgatttccatggaagaaacaattttctagaagga
aagaataataaagaaatgatgaaatggccagcaaatgaagatcactgggtttggatacaa
gcgaatgcacaagtttgttatcgggacggttcttccgactatgccactgccctacagcag
gcccccaaggaaggagacgaccatcagaagatacccaacagcatgacgagcctgaaaggg
aacagggatgcacttgatccgatgaagcaccacaaatggactacaatgaaaaaagagcag
gactgcataaaagtcaagtttgagcctcacgcagatgacgacggtgaatattttagtccg
caagaatttgtcagttctaatgggccactctttggtgttcaacacagtaacaacccaaat
ggcacatggacttcaaggaatccatcaagttcctgcactagagggcagcacaacgaaaat
atgtgcccaaacaaaactgtgaggccattctacagcagagaccagcaggtctgcggttta
tctgccgcctgttcgtcacactggggaggcatacagaattaccagcctcacgcgcactcg
cagcaatacacagcagacggccattcggcagaaggcacgaaactgcagtgcccgctaata
tctccagaagcactgtacagccctcagaacacactgatcaaaactgaatatgattcagat
tctgaaaatgtagctaatagttatgccgtttccccaagtcaagtctggatggatgaaaag
agtgtagcaaagaagcactcaagtcatttcccttctagggtccatctgaaagcagaactg
gaattcaacaaacagccgcctctgtgccaaagtccaaagcgctgggtttactcaccatat
aattggcaacgccttgtgatgcatcacaccaacaacatcagtagaaacggatctggcaaa
ggggtgcattacaaggagacaacgccactgggtccgcggaaccccatctgtgtagatact
acggagggtacacaaggaacatattgctgtgatacgttttataataccagttttatagac
gagacagagcaaaatacccaggtcctgaagacacactgtgagtttaagagtcccagcttt
attccagcaatcaagcatgaacctttagagtctccacctatagctggcagtggtcagaat
ggagtccaagctactttctctgaaaatgtattcggttctcagcctcataaaataatgggg
tgtgcattttcacgacaaactgtgtag

DBGET integrated database retrieval system