KEGG   Gekko japonicus: 107106069
Entry
107106069         CDS       T04299                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
gja  Gekko japonicus
Pathway
gja04080  Neuroactive ligand-receptor interaction
gja04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107106069 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107106069 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 107106069
NCBI-ProteinID: XP_015261640
Position
Un
AA seq 78 aa
MGVRRWLLALLLLWLALSPGSGGPLTETSDDGKEPREGHIRNLVHPKGVRSAVGHRPNGW
RKYRRPRPRLSHKGPMPF
NT seq 237 nt   +upstreamnt  +downstreamnt
atgggcgtgcggcgctggctgctggcgctgctgctgctctggctggctctcagccccggc
tccggagggcctttgactgaaacatccgatgatgggaaggagcccagggaagggcacatc
cggaacctggtgcatcccaaaggagtccggagcgctgtgggacaccggccgaatggctgg
cggaaatatcggcgtcctcgcccccgcctctcccacaagggacccatgcctttctag

DBGET integrated database retrieval system