KEGG   Gekko japonicus: 107106275Help
Entry
107106275         CDS       T04299                                 

Gene name
CACNG3
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 3
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04260  Cardiac muscle contraction
gja04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107106275 (CACNG3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107106275 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    107106275 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:gja04040]
    107106275 (CACNG3)
Ion channels [BR:gja04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107106275 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 107106275
NCBI-ProteinID: XP_015261883
Position
Un
AA seq 245 aa AA seqDB search
TFRGICKQINHFPEDGDYEQDAAEYLLRAVRASSIFPILSVGLLFFGGLCVAASEFYKSK
LNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQSDSKKSYSYGWSFYFGALSFIIAEM
VGVIAVHMYIERHRQIRAKSHSVALLKKSTFARLPTYRYRFRRRSSSRSTEPRSRDLSPI
GKGFTTIPSTDISMFTLSRDPSKVTIGTLLNSERDHGFLQIHNSLPKEFKESLHNNPASR
RTTPV
NT seq 740 nt NT seq  +upstreamnt  +downstreamnt
ggaccttccgaggaatctgtaaacaaatcaaccattttccggaagatggcgactatgaac
aggatgcggcggaatacctcctgcgtgccgtgagggcatccagcatcttccccatcctga
gcgtgggtcttctgttcttcgggggcttgtgtgtggcggccagtgagttctacaagagca
aactcaacgtcatcctgagcgccgggatctttttcgtgtcggcaggactgagcaacatca
tcgggattatcgtttacatctcggccaacgctggggatcccgggcagagcgactccaaga
agagctactcctacggctggtccttctacttcggggccttatccttcatcatcgccgaga
tggtgggagtcatcgccgtccacatgtacattgagaggcaccgccagatccgagccaagt
cccactcggtggcgctgctgaagaagtccaccttcgcccgcctgcccacctaccgctacc
gcttccggaggagatccagctcccgctccacggagccccggtcgcgggacctctccccca
tcggcaagggcttcaccaccatcccctccaccgacatctccatgttcaccttgtcccggg
acccctccaaggtgactatcgggaccctgctcaactccgagagggatcacgggtttttac
agattcacaactccctccccaaagagttcaaggagtcgctgcacaacaaccccgccagcc
gacgaaccactcccgtctga

DBGET integrated database retrieval system