KEGG   Gekko japonicus: 107106285Help
Entry
107106285         CDS       T04299                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
gja  Gekko japonicus
Pathway
gja03040  Spliceosome
gja04010  MAPK signaling pathway
gja04141  Protein processing in endoplasmic reticulum
gja04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:gja00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107106285
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107106285
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107106285
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107106285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gja01009]
    107106285
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gja03041]
    107106285
   03009 Ribosome biogenesis [BR:gja03009]
    107106285
   03110 Chaperones and folding catalysts [BR:gja03110]
    107106285
   04131 Membrane trafficking [BR:gja04131]
    107106285
   03051 Proteasome [BR:gja03051]
    107106285
   03029 Mitochondrial biogenesis [BR:gja03029]
    107106285
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gja04147]
    107106285
Protein phosphatases and associated proteins [BR:gja01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107106285
Spliceosome [BR:gja03041]
 Complex B
  Other components
   Prp19 complex
    107106285
 Complex C
   Prp19-CDC5 complex
    107106285
Ribosome biogenesis [BR:gja03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107106285
Chaperones and folding catalysts [BR:gja03110]
 Heat shock proteins
  HSP70 / DNAK
   107106285
Membrane trafficking [BR:gja04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107106285
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107106285
Proteasome [BR:gja03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107106285
Mitochondrial biogenesis [BR:gja03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107106285
Exosome [BR:gja04147]
 Exosomal proteins
  Proteins found in most exosomes
   107106285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA MetOD2
Motif
Other DBs
NCBI-GeneID: 107106285
NCBI-ProteinID: XP_015261898
Position
Un
AA seq 646 aa AA seqDB search
MSKGPSVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFTVVNDAGRPKVQVEYKAETKCFYPEEIS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQVHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKISDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagggaccatctgttgggattgatcttggcaccacatattcctgtgttggtgtc
ttccaacatggcaaagtggaaatcattgccaatgaccagggtaacagaaccacaccaagc
tacgttgccttcaccgataccgaaaggcttatcggtgatgccgcaaagaaccaagtggca
atgaaccccactaacacagtttttgatgcaaagcgcctgattggtcgcagatttgatgat
gctgtcgtccaatctgatatgaagcactggcctttcactgtcgtgaatgatgcaggcaga
ccaaaagtccaggtggagtacaaagcagagacaaaatgcttttacccagaagaaatatct
tccatggtgctaacaaaaatgaaggagatagcggaggcatacctgggaaagactgttacg
aatgcagtggttaccgtcccagcttatttcaatgactcccagcgccaggctacaaaagat
gccggaaccattgctggtctcaatgtgctccggatcattaatgagccaactgctgctgct
attgcttatggtttggataaaaaagttggtgctgagagaaacgtcttgatctttgacctc
ggcggtggcaccttcgatgtctccatcctcacaatcgaggatggcatctttgaagtgaag
tccacggcaggcgacacccacttgggtggcgaagactttgacaaccgcatggtcaatcat
ttcattgctgagttcaagcgcaaacacaagaaggacatcagtgagaacaagcgggccgtc
cgccggctccgcaccgcctgcgagcgggccaagcgcacactgtcctcgagcactcaggcc
agtattgagatcgattccctgtacgagggcattgacttctatacctcaattacaagagct
cgttttgaagagctgaacgccgacttgttccgcggcactctggatcccgtggagaaggcc
ctgcgggacgccaagctggacaaatctcaggtgcacgacatcgtcctggttggcgggtcc
acccgaatccccaagatccagaagctccttcaggatttcttcaatggcaaggaactgaac
aagagcatcaaccctgacgaagctgtcgcttacggcgcagctgttcaagctgccattttg
tctggggacaaatcagagaatgtgcaagacctgctcttgctggacgtcactcctctgtca
ctgggtatcgaaacagccggtggtgtcatgaccgtactgatcaagcgcaacaccacaatt
cctaccaagcagacccagacgttcacaacgtactctgacaaccagccaggagtactgata
caggtttatgaaggagagagagcgatgaccaaggacaataacttgctgggcaagtttgaa
ttgactggcattcctccagccccaaggggtgtacctcaaattgaagtaacatttgatatt
gatgccaatggtatcctcaacgtgtcggccgtggataagagcaccggaaaggagaacaaa
atcacaatcaccaatgacaaaggccgtcttagcaaggaagatattgagcgtatggtgcag
gaagcagaaaaatacaaagctgaagacgaaaagcagcgcgataaggtgtcatccaagaac
tcccttgaatcctatgctttcaatatgaaggcgactgtggaagatgagaaacttcaaggc
aaaatcagtgatgaagacaagcagaagatcttggataaatgcaatgaaataatcaactgg
ctggataagaatcagactgctgagaaggaagaattcgagcaccagcagaaagagctggag
aaggtttgcaatcccatcataacgaagctgtaccagagtgcaggtgggatgcccggaggc
atgcccggcggcttccctggcggtggagcacccccctccggaggagcatcttctggacca
accatcgaggaggtggattaa

DBGET integrated database retrieval system