KEGG   Gekko japonicus: 107106472Help
Entry
107106472         CDS       T04299                                 

Gene name
IDE
Definition
(RefSeq) insulin degrading enzyme
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gja01002]
    107106472 (IDE)
Enzymes [BR:gja01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     107106472 (IDE)
Peptidases and inhibitors [BR:gja01002]
 Metallo peptidases
  Family M16: pitrilysin family
   107106472 (IDE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C Tn916-Xis
Motif
Other DBs
NCBI-GeneID: 107106472
NCBI-ProteinID: XP_015262112
Position
Un
AA seq 567 aa AA seqDB search
MNDSAIKRIATDIIKSPEDKREYRGLKLANGIKAMLISDPTTDKSSAALDVHIGSLSDPP
NIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGA
LDRFAQFFLCPLFDENCKDREVNAVDSEHEKNLMNDAWRLSQLEKATGNPNHPFSIFGTG
NKYTLETRPNQEGIDVRQELLKFHSTYYSSNLMAVCVLGRESLDELTNLIVKLFSEVENK
NVPLPEFPEHPFQEEHLRQRYKVVPIKDIRNLYVTFPIPDLQKYYKSNPGHYLGHLIGHE
GPGSLLSELKAKGWVNTLVGGQKEGARGFMFFIINVDLTEEGLLHVDDIILHMFQYIQKL
RTEGPQEWVFQECKDLNAVAFRFKDKERPCGYTSKIAGMLHYYPIEEVLAAEHLLEEFRP
DLIEMVLDKLRPENVRVAIVSKTFEGKTDRTEKWYGTQYKQEAISDEVIKKWENADLNGK
FKLPMKNEFIPTNFEIVPLEKDAPQYPTLIKDTAMSKLWFKQDDKFFLPKACLNFEFFRY
VTIFASKMYHNEYGNFLKEIFKSREYE
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcagctatcaaaagaatagcaactgatattatcaagtcacctgaggataaa
cgagagtatcgtgggctaaaacttgcaaatggcataaaggcaatgcttatcagtgacccc
actacagacaagtcttcagctgcgcttgatgtacacatagggtcactatcagatccgcct
aatattgcgggattaagtcacttttgtgaacatatgctgttcttgggaacaaaaaaatac
cccaaagaaaatgaatacagccagtttcttagtgaacatgcagggagttcaaacgctttt
accagtggagagcacaccaactattactttgatgtttcacatgaacacctggaaggtgcc
ctggacaggtttgcacagtttttcttgtgccctctgtttgatgaaaactgcaaagaccga
gaagtaaatgcagttgattctgagcatgagaagaacttaatgaatgatgcctggagactc
agtcagctggagaaggctactggaaaccccaatcaccccttcagcatatttggaacagga
aacaaatacactttggaaacaagaccaaaccaagaaggaatagatgtcagacaagagcta
ttgaagtttcactccacatattattcatcaaatttaatggctgtctgtgttctaggacga
gaatcgctagatgagttgaccaacttgatagtaaagctgttctctgaagtagaaaacaaa
aatgttcctttaccagaattccctgaacaccctttccaggaagaacatcttcggcaacgt
tacaaagtggtacctattaaagacatcagaaatctttatgtcacgtttcccataccagac
cttcagaagtattataagtcaaaccctggtcattatctcggtcaccttattgggcatgaa
ggtccaggaagtcttttatcagaactcaaagctaaaggctgggtaaatacactggttgga
ggacaaaaagaaggtgctagaggtttcatgtttttcatcattaatgttgacctcactgaa
gaaggacttttacacgtggatgatattattttgcacatgttccagtatatacaaaagttg
agaacagaaggaccccaagagtgggtttttcaggaatgtaaggatctaaatgctgtagcc
ttcagatttaaagataaagaaaggccctgcggttacacatcaaaaattgcagggatgctg
cattattatcccatagaagaagttcttgcggctgagcatttactagaagaatttaggcct
gatttaattgaaatggtgctggataaactgagacctgaaaatgtccgggttgcaatagtt
tctaagacttttgaaggaaaaactgatagaacggaaaagtggtacggaacccaatacaag
caagaagcaatttctgatgaagtcattaagaaatgggaaaatgctgaccttaatgggaaa
ttcaagctcccaatgaagaatgaatttattcctacaaactttgaaattgtaccactagaa
aaggatgcaccacagtaccctactcttattaaggacactgctatgagcaagctgtggttc
aagcaagatgacaaatttttcctgcctaaagcttgtctcaactttgaattcttcaggtat
gtaaccatttttgcctccaaaatgtatcataatgaatatggcaattttttaaaggaaatt
tttaaatcaagagaatatgaatga

DBGET integrated database retrieval system