KEGG   Gekko japonicus: 107106771Help
Entry
107106771         CDS       T04299                                 

Gene name
MRVI1
Definition
(RefSeq) murine retrovirus integration site 1 homolog
  KO
K12337  inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate
Organism
gja  Gekko japonicus
Pathway
gja04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:gja00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107106771 (MRVI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRVI1
Motif
Other DBs
NCBI-GeneID: 107106771
NCBI-ProteinID: XP_015262448
Position
Un
AA seq 825 aa AA seqDB search
MSASAIKVILDLSYLPYVEPPELLASTFATILKYTSNAKEMSVLVYDEVISVNQPFSPRL
EADYNEKQCTKEPPAEVAISNTPAIVLPENTVIQDTEKERNLSLRASRSTNNTGHVIDLV
NDQLPEVKISDEDKKKNLELLEEAKRVSERFLTRRGRKSRSSLSESPTGMSPTLSPSVSP
APSRSNSFNLPSPTGSDTCTFTVGSVSPLQNATKGLNDQKQNDQRKLSQGRLLPRLTGFE
NPKENLSEQKENFDPHKLMDNLSRSCTSVTDVGRLSLKSSANTCEHELGKPFFKITKGKD
FPFKGNSQEPEMATVDPKLKGLVPLLKDSKVTCKTDLTTPGTHPPLLRSISWDHVEPGNI
EKAPFKQPSDYDKNVSIMNKSSNTSTKPSTFKDLQIQVQPVRMQKLTKLREEHILMRNQN
LVGLKLPDLSETAEQERGSSPSFFEEDEEEEDEEGAENSCDVMPNIPDALLRKLRVHTSL
PESCPPLTEKEVENVFIQLSLAFRNDSYTLESRINQAERERNLAEENTEKELDNFKVAIT
SSASLWHHSEHREMYQKLLEDITVLHRLASRLSSRAEMVGAVRQEKRMSKATEVMMQYVE
NLKRTYEKDHAELMEYKKLANQNSSRSYSSPEDGVPRTSRSMSLTVGKAPRRRVSVAVVS
KFEIPGQSPSMSPIPLMPSMTESTNGRNNLTTTSVLPALLEKYQEGLKKSRDLEELIEDD
EEKIVEGPNECEEDESGDETGRHGKLEVVIHYIQILYPKLQKHWNVLWIVAAIVIIFAVV
LGISSLYSYFSCAELSDGQQVKATCSAAQQYSWWNSGLHHDQHTE
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcctctgcaatcaaggttatccttgatttatcctacttgccttatgtagaacct
ccagagctcctggcttccacatttgctacgattctgaaatacacaagtaatgctaaagaa
atgtcagtgctggtctatgatgaagtcatatccgtaaatcagcctttctctccaagactt
gaggccgattataatgaaaaacagtgtacaaaggagccccctgctgaagtagcaatatcc
aatacacctgctatagttcttccagaaaatacagttatacaagatacagaaaaggaaaga
aatctatccctcagggctagcagatctactaacaatacaggtcatgtgattgacttggtg
aatgatcaactgccagaagttaaaatctctgatgaagataaaaagaagaaccttgagttg
ttagaagaagcaaagcgagtgagtgagaggttcctcacacgcagaggaagaaaatcaaga
agcagcctttcagagtctcccacaggcatgtccccgacgcttagtcccagtgtttcacct
gcaccatctcggagcaactctttcaatcttccaagtccaacaggttctgatacgtgtaca
ttcactgttggttcagtgtctccgctgcagaatgctacaaaaggactaaatgatcagaaa
cagaatgatcaaagaaaactttctcagggaagattgcttcctcgcttaactggttttgaa
aacccaaaagagaatctgtctgaacaaaaggaaaactttgatccacataaacttatggat
aatctgtctagatcttgcacttcagttactgatgttggcagactatctcttaaaagcagt
gcaaatacttgtgaacatgaacttggaaaaccattctttaaaataacaaaaggaaaagat
tttcctttcaaaggcaattcacaagaaccagaaatggctacagtagatccaaagctaaaa
ggtttggtaccattactgaaggattcaaaagttacttgtaaaacagaccttactacacct
ggtacacaccctcctctactacgatcaatatcatgggatcacgtagaacctggtaatata
gaaaaagcaccttttaaacaaccatctgattatgataaaaatgtttccattatgaataaa
tccagtaacacctcaacgaagccatcaacttttaaagatctccaaatacaagtgcaacct
gttcggatgcagaaattgacaaaactcagagaggagcacatattgatgcggaatcaaaat
ttggtaggacttaaactccctgacctcagtgaaactgcggaacaggaaagagggtcttca
ccatccttttttgaggaagacgaggaggaggaggatgaggagggtgcagagaatagctgt
gatgtcatgcccaatattcctgatgcactcttacgaaaactccgtgtgcatacatctctt
ccggaaagctgtcctccactcactgagaaagaggttgagaatgtatttatacaactttca
ttggctttccgaaatgatagttacactttggaatcgagaattaaccaggctgagagggag
agaaatcttgcagaggagaacacggagaaagaactggacaattttaaagtagctattacg
tcttcggcttccttatggcatcattctgaacacagagagatgtaccagaaattgttggag
gatatcactgtgctgcatcgtttggcctctagattatctagccgggctgaaatggttgga
gctgttcgccaggagaagcgcatgtcaaaggccactgaagttatgatgcagtatgtggag
aatttgaagagaacatatgaaaaggatcatgctgagcttatggagtataagaaacttgcc
aatcagaattctagcagaagctacagttctcctgaggatggtgttccacgtacatctaga
tccatgtctcttacagttggaaaggcacctcggaggagagtcagtgttgctgttgtttca
aaatttgaaatcccaggccagtcacctagcatgtcacccattcctttgatgccatccatg
actgaatcaacaaatggaagaaacaatctgacaacaacttctgtcttacccgcactttta
gagaaatatcaggaaggcttaaagaaatctagagaccttgaagagctaatagaagatgat
gaagaaaaaatagttgaagggcccaatgaatgtgaagaggatgaaagtggtgatgaaact
ggcagacacggcaaacttgaagttgttatccattatatacaaatactctaccccaaactg
caaaaacattggaatgtactctggattgtagcagccatcgtcataatttttgctgtggtg
ctgggaatctccagtttatacagttacttctcctgtgctgaattatcagatggacaacaa
gtgaaagctacctgctctgctgctcagcagtactcctggtggaactcaggactacatcat
gaccagcacacagaatga

DBGET integrated database retrieval system