KEGG   Gekko japonicus: 107107280
Entry
107107280         CDS       T04299                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gja01002]
    107107280 (ERAP1)
Enzymes [BR:gja01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     107107280 (ERAP1)
Peptidases and inhibitors [BR:gja01002]
 Metallo peptidases
  Family M1
   107107280 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N BLOC1_2 Prefoldin_3
Other DBs
NCBI-GeneID: 107107280
NCBI-ProteinID: XP_015263036
Position
Un
AA seq 928 aa
MVKIFLLLGILNLATLLSCDHHTETGYSSKPFPWNKVRLPKHVVPIHYDLLIHPNLTTLT
FTGFAKIEITVLQQTSSIILHSKYLHISKATIQGEMGGIHAEQGVTVSEYPPFEQIALLT
DEPLQVGKNYSIVTEYSANLSDSFHGFYKSTYRTPEGEVRVLALTQFEPTAARMAFPCFD
EPAFKARFSVKIRREPKHHALSNMPLVKSVNIMEWLIEDEFETSVKMSTYLVAFMVSDFK
SVTKMTTRGIKVSVYTVPYKIKQADYALDSAVKLLDFYEGYFSIPYPLPKQDLAAIPDFQ
SGAMENWGLTTYRESGLLYDPEKSSASSRLMITMFIAHELAHQWFGNLVTMEWWNDLWLN
EGFAKFMEYVSVNITHPDLGVEDYFLDKYFDAMEVDALNSSHPITTAVEDPAQILEMFDE
VSYDKGSCILNMLRDYLGSKVFEAGIVKYLQRFSYQNTQSEDLWNSLSEICPASSTDESQ
AEDGACARSQETISASHWSKSALHDVKTMMNTWTLQKGFPLVTVTVREKNIHLQQEHYMK
GSQISPPTGYLWHIPLTYITSKSDIVQRFLLRTKTDSVVLPEEVEWIKFNVGMNGYYIVH
YGDDGWDALIHLLKANHNAISSSDRASLINSVFQLVSAEKLCITKALDLTLYLRHESKVK
PVSQGLSELVPIYKLLEKRDMSDTADQLKGYLVNLFKNIIDKQSWTDEGSMAERILRSTL
LIFACVRKYQPCVDKATEYFMKWKDSDGTLHLPNDIKLAVYAVGAQTDEGWDFLFSKYQL
PKFSTEKGQIEMVLSLSHNKEKLQWIMDQALQGDIIKTQNLPHIVVAVGRNPDGYQLAWK
FLKEKWPKLVQKFELGSHSIANMIIGVTNKYSTKAQLEEVKDFFSSLDKKSSQLRSVEQA
IETIEENIKWMHKNLGKIQKWLQINSKV
NT seq 2787 nt   +upstreamnt  +downstreamnt
atggtgaagatattcttattgctgggtattctaaatcttgctactctgttgagctgcgat
caccatactgagacaggctattcaagcaaaccatttccttggaataaagtgaggcttccc
aagcatgttgttccaattcattatgaccttcttattcacccaaatctgaccactcttact
tttactggatttgccaaaatagagattacagtacttcaacaaaccagttcaatcatcctg
catagcaaatatctccatatctccaaagcaaccatccaaggagaaatgggaggcattcat
gctgaacaaggagtgacggtttcagaatatccaccatttgaacagattgcacttcttact
gatgaaccactgcaagttggaaagaactattctattgttactgaatattctgctaatttg
tcagacagtttccatggcttctataaaagtacatacagaactccagaaggagaagtaagg
gtgcttgcattaacacagtttgaaccaacagccgcacgaatggccttcccttgctttgat
gaacctgcattcaaggctagattttctgttaagatcagaagagaaccaaaacatcatgca
ttatctaacatgcctttagtgaaatcggtaaacatcatggaatggctcattgaagatgag
tttgagactagcgtaaagatgagcacctatctagtagccttcatggtttcagatttcaaa
tcggtcacaaagatgaccacccgtggaattaaggtttcagtatatactgttccatacaag
atcaagcaagcagactatgccttggattcagcagtgaaactactagacttctatgaggga
tattttagcattccatatcctttgcctaaacaagacttagctgctattcctgattttcag
tctggagcaatggagaattggggactgactacatacagggaaagtggcttgttatatgat
cctgaaaaatcatcagcatcatctagacttatgattactatgtttatagcccatgaactt
gctcaccaatggtttggaaacctggtcaccatggagtggtggaatgatctttggctgaat
gaaggatttgcaaagtttatggagtatgtgtcggtaaacattacccatccagatctggga
gttgaagattattttttagacaagtattttgatgccatggaggtggatgcattgaattcc
tcacaccctataactactgctgttgaagatccagctcagattctagaaatgtttgatgag
gtttcctatgataagggatcttgcattcttaatatgctaagggactatctcggctcaaag
gtgtttgaagctggcattgtaaaatatttgcaacgatttagctatcaaaatacacaaagt
gaagatctgtggaacagcctgtcagaaatttgtcctgcaagtagcaccgatgaaagtcaa
gcagaagatggggcatgtgccagaagccaggagacaatctcagcttcacactggagcaag
agtgcactccatgatgtaaagacaatgatgaacacttggacactgcaaaaaggattccca
ttagtaactgtgacagtgagagagaaaaacattcatctccagcaagaacattacatgaag
ggctctcagatttctccaccaacagggtacctatggcacattccactaacgtacattacc
agtaaatctgacattgttcaaaggtttttgctgagaaccaaaacagatagcgttgtcctc
ccagaagaagtggaatggataaaattcaatgtgggaatgaatggttattatattgtgcac
tatggagatgatggctgggatgcactgatccaccttttaaaagcaaaccataatgcaatt
agcagcagtgacagagccagccttatcaacagtgtattccagctggtgagtgctgaaaag
ctgtgcattaccaaagctcttgatttaactttatacctaagacatgaatctaaagttaaa
cctgtatctcaaggattgagtgaactggttcctatatacaagctgctggagaaaagggat
atgagtgacacagcagatcaattaaagggatatttagtaaatctctttaaaaacataatt
gacaaacaatcttggaccgacgaaggctccatggctgagcgaatacttcgcagtaccctt
ctcatatttgcttgtgtgcgcaaataccagccatgtgtggacaaagcaacagagtatttt
atgaagtggaaggactctgatggaactctacatttgcccaatgatattaaactagcagta
tatgctgttggcgcacagactgatgaaggctgggacttcctttttagcaaatatcagcta
ccaaagttcagcactgaaaaaggccagattgaaatggtcctttccctgagtcacaataag
gaaaagcttcagtggataatggatcaagcattgcaaggtgacattataaagactcaaaat
cttccccatattgttgtggctgttggaagaaatcctgatggttatcaattggcttggaag
ttcctgaaggagaaatggccaaaacttgtacaaaagtttgaactcggctcacattccatt
gcaaacatgattattggagtaacaaataagtattctacaaaggcacagcttgaggaggta
aaagacttcttcagctctcttgacaagaaaagctcacagcttcgttctgttgaacaagca
atagaaactattgaagaaaatatcaagtggatgcataagaaccttggaaaaatacagaag
tggttacagattaacagcaaagtgtga

DBGET integrated database retrieval system