KEGG   Gekko japonicus: 107107695Help
Entry
107107695         CDS       T04299                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1B-like
  KO
K08795  pregnancy upregulated non-ubiquitously expressed CaM kinase [EC:2.7.11.17]
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107107695
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107107695
Protein kinases [BR:gja01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   107107695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 107107695
NCBI-ProteinID: XP_015263491
Position
Un
AA seq 378 aa AA seqDB search
MPFGKGWKKKVEDITAVYDIKEKLGAGAFSEVVLAQEHGSQRLVALKCIPKKALRGKEAA
VENEIAVLKKIQHENIVALEDFYESPTHLYLAMQLVTGGELFDRIIERGYYTEKDASLLV
RQVLEAVNYLHSLGIVHRDLKPENLLYATPFEGAKIMITDFGLSKIEADGIMSTACGTPG
YVAPEILEQKPYGKSVDSWALGVISYILLCGYPPFYDENDSELFNQILKAEYEFDSPYWD
DISESAPEILEQKPYGKSVDSWALGVISYILLCGYPPFYDENDSELFNQILKAEYEFDSP
YWDDISESGFRLPISGDTALEKDIHGSVCEQIQKNFARSQWKRAFNATSFLRHITKLGPG
AEGEEIGEATSGGEHGKW
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgccgttcgggaaaggctggaagaagaaggtggaggacatcacggccgtctacgacatc
aaggagaagctgggcgcaggggccttctccgaagtggttctggcccaggaacatggatcc
cagcgtttggtggcgttaaaatgtattccgaagaaagccctgaggggcaaggaagcagcg
gtggagaatgaaattgcggtactcaagaagattcaacatgagaacattgtggctctggag
gacttctatgagagccccacgcatctctacctggccatgcagctggtgacgggaggggag
ctcttcgaccgcatcatcgagcggggctactacacggagaaggacgccagcctcctcgtc
cggcaggtcttggaagcggtgaattacctgcacagcctgggcatcgtccatcgagatctc
aagcccgagaaccttctctatgccactccgttcgagggcgccaagatcatgatcacggac
ttcgggctgtccaagattgaggccgacgggatcatgtccacggcgtgtggcacccctggc
tacgtggcccctgagattctggagcagaagccatacggaaaatccgtggactcgtgggcc
ctcggggtcatctcgtacatcttgctgtgcggttaccccccgttctacgacgagaatgac
tctgagctcttcaaccagattctgaaagctgaatacgagttcgactccccgtactgggac
gacatctccgagtcggcccctgagattctggagcagaagccgtacggaaaatctgtggac
tcgtgggccctcggggtcatctcgtacatcttgctgtgcggttaccccccgttctacgac
gagaatgactctgagctcttcaaccagattctgaaagctgaatacgagttcgactccccg
tactgggacgacatctccgagtcgggtttcaggcttccgatctctggcgatacggctctg
gaaaaagatattcacggttccgtgtgtgagcagattcagaagaacttcgctcgcagtcag
tggaagcgagcgttcaacgccacgtctttcctgcgccacatcaccaagctggggccgggc
gctgagggcgaggagatcggagaggccacatccgggggagagcacgggaaatggtga

DBGET integrated database retrieval system