KEGG   Gekko japonicus: 107107973Help
Entry
107107973         CDS       T04299                                 

Gene name
NIT1
Definition
(RefSeq) nitrilase 1
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107107973 (NIT1)
Enzymes [BR:gja01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     107107973 (NIT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 107107973
NCBI-ProteinID: XP_015263835
Position
Un
AA seq 345 aa AA seqDB search
MYAWGEEGEGLRRAVQKPLQTYLESFFLPRPWKQYWQIKSQTPAHRLSAAPCGFRVMSTG
TGTLKPLIAVCQVTSIPNKDHNQECCSRLIREAAQRGACVVFLPEAFDFIGSNTEETLSL
AEPLEGDLIRYYASLARECGVWLSLGGFHERGSDWESTHRIYNCHLLLDTKGTLVAAYRK
THLCDVELEGRVSMKESAFTNPGLEIVSPISTPAGKVGLAICYDLRFPEMSLALAQKGAE
ILTYPSAFTVTTGSAHWEVLLRARAIETQCYVVAAAQTGKNHERRTSYGHAMIVDPWGSV
IAQCQEGPGLCYAEIDLAYLHHIRQEIPVFQHRRPDLYGRVAPLS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcatggggggaagagggagaagggctgagaagagcagtccagaaacctctgcaa
acctatctggagagcttcttcctccccaggccctggaagcaatattggcagatcaaaagc
cagacacctgcccacagactctctgctgccccctgtggattcagagtcatgtctacaggc
accggaaccctgaagcctctcattgctgtctgccaggtgacctcaatccccaacaaagac
cataaccaggaatgctgctcacgcctcatccgggaggcagcccagcggggcgcctgtgtg
gtcttcctccctgaagcctttgatttcattggcagcaacacagaagagaccctcagcctg
gctgagcccctggaaggagatctcatccggtattacgctagcctagccagagaatgtggg
gtctggttgtcccttggaggcttccatgagagaggcagcgactgggagagcacgcaccgg
atctacaactgccatctgctcctggacaccaaaggaaccttggtggccgcctacagaaag
actcacctctgcgacgtggagctggagggacgggtgtccatgaaggaaagcgcctttacc
aatccaggtttggagattgtgtcgcctatcagcaccccggctggaaaggttggcctggcc
atctgttacgacctacgtttcccagagatgtcactcgctctggcccagaaaggggcagag
atcctgacctatccgtcggccttcacggtgaccacaggttctgctcactgggaggtgctg
ctacgagctcgcgccattgagacccagtgctacgtagtcgcagccgctcagacaggcaag
aaccacgagcgccgcacctcctacggccacgccatgatagtggacccctggggcagcgtc
atcgcccagtgccaagagggaccgggcctctgctatgctgaaattgacctggcttacttg
catcacatccggcaggagatacccgtcttccagcaccgccggcccgacctgtatggccgg
gtggcccccttgtcatga

DBGET integrated database retrieval system