KEGG   Gekko japonicus: 107108130Help
Entry
107108130         CDS       T04299                                 

Definition
(RefSeq) apoptosis regulator Bcl-2-like
  KO
K02161  apoptosis regulator Bcl-2
Organism
gja  Gekko japonicus
Pathway
gja04115  p53 signaling pathway
gja04140  Autophagy - animal
gja04141  Protein processing in endoplasmic reticulum
gja04210  Apoptosis
gja04217  Necroptosis
gja04261  Adrenergic signaling in cardiomyocytes
gja04340  Hedgehog signaling pathway
gja04510  Focal adhesion
gja04621  NOD-like receptor signaling pathway
gja04933  AGE-RAGE signaling pathway in diabetic complications
gja05132  Salmonella infection
gja05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:gja00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107108130
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    107108130
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107108130
  09143 Cell growth and death
   04210 Apoptosis
    107108130
   04217 Necroptosis
    107108130
   04115 p53 signaling pathway
    107108130
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107108130
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107108130
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107108130
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107108130
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107108130
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107108130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gja01009]
    107108130
Protein phosphatases and associated proteins [BR:gja01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107108130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 107108130
NCBI-ProteinID: XP_015264017
Position
Un
AA seq 258 aa AA seqDB search
MMAHPGIREYNSREIVLRYLHYKLSQRGYDWIASGDRANLLSPAAAGTFRALAPLASFPS
ESPGSAAASHTGLVEELHPVPQVVHLTLRQAGDEFSRRYQRDFAQVSGQLHLTPVTARSR
FVGVVEELFRDEVNWGRIVAFFEFGGMMCVESVSREMSPLVDSIAVWMTEYLNGHLRHWI
QDNGGWSQATELLLQDILKGIGKAIQGSLGVSAQLYSFGLQLLPDVLYVQLLSGNRGHRG
TLQSPGAGPHLPATTRLR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatggctcatcctggaataagagaatacaacagcagggagatcgtgctcagatatctc
cattacaagctttcccagagaggctatgactggattgccagtggagacagagcaaacctt
ctttctcctgctgctgctgggaccttccgtgcccttgctccgctggcctctttcccgtct
gagtcccctggctcagctgctgctagccacacgggtctggttgaggagctacacccggtg
ccacaggttgtccacttgacgttacgccaagctggcgatgagttttcgcggcgttatcag
cgggacttcgcccaggtgtctggccagctgcacttgaccccagtcacggccaggagtcgc
tttgtaggagtcgtggaagagctcttccgagacgaggtcaactgggggaggattgtggcc
ttcttcgaatttgggggcatgatgtgcgtggagagcgtcagtcgggagatgtctcctctg
gtggacagtatcgccgtgtggatgacggagtacctgaacggacacctgcggcattggatc
caggacaacggaggttggtcccaagccacagagctcctgctgcaggacatcctgaaaggc
atcgggaaggccatccagggaagcttgggtgtctctgcgcagctctacagttttggtctt
cagctcctgccggacgtgctctacgtccaattgctgtcgggcaatcgtggtcatcgtgga
actctccagagccctggtgccggtcctcatctgcctgccaccaccagactccggtag

DBGET integrated database retrieval system