KEGG   Gekko japonicus: 107108466Help
Entry
107108466         CDS       T04299                                 

Definition
(RefSeq) transmembrane protein 132C-like
  KO
K17599  transmembrane protein 132
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gja01009]
    107108466
Protein phosphatases and associated proteins [BR:gja01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107108466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM132D_C TMEM132
Motif
Other DBs
NCBI-GeneID: 107108466
NCBI-ProteinID: XP_015264389
Position
Un
AA seq 396 aa AA seqDB search
EAILSSWIQFSDGSVTPLDIYDPKDFSLSASSLDESVVSAHLSSTTKWPVVAAEGEGQGM
LVKVDMMISEACQKSKRKSVLAVGSGSIKVKFGQNDANAHGVSDYDADEIENHASDRRQK
VLDQERYGQDGRYYGSSSAEREDGAARKVSTTAKSMIKGKVLKSNLAGDKLSDDGQLQNI
PIDFTNFPAQIDLPKNDGSMDDSDLVQAPRGLSDLEIGMYALLGVFCLAILVFLINCATF
TLKYRHKQVPVEGQATMSHSHDWVWLGNETELLENQVDISPPQDERTTNVDRGIGSEESN
QLLNGSMPKSIQSQLHKSADSGGKQGKEQKLNPPLHSPTSKRKRVKFTTFTTIPPDDSCP
TINSILSCNEDDIKWVCQDMDLGETKHYMEKIKEKA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gaagccatcctgagctcctggatccagttcagcgatggctctgtgactccgctggacatt
tacgatcccaaagacttttccctctctgcttcatcactggacgaatctgtcgtttcagcc
cacctgagttctactacaaaatggccagtggtggcagcagaaggtgaaggacaaggcatg
ttggtcaaagtggacatgatgatctctgaagcttgccagaagtccaagaggaagagtgtc
ctggcagtgggcagcggcagcatcaaggtgaagttcggccagaatgatgccaatgcccat
ggcgtcagtgattacgacgccgatgagatcgaaaaccacgcaagcgaccggaggcagaag
gtgttggaccaagagcggtatggccaagatgggcgatactacgggagttcttctgccgaa
cgagaagacggtgccgcacggaaagtcagcaccacggcaaaatctatgatcaaaggcaaa
gtactgaagagcaacctggctggagacaagctctccgacgatgggcagctgcagaacatc
cccatagacttcaccaactttccagcccagatcgacctccccaagaacgatggcagtatg
gacgacagtgaccttgtgcaggcccctaggggactcagtgacctggagattgggatgtat
gctctcttaggggtcttctgcctggcgattctcgtcttcctgataaactgtgccaccttc
acgttgaaatatcggcacaagcaagttccggtggaagggcaggccaccatgagccactcc
cacgactgggtgtggcttgggaacgaaaccgaactgctggagaaccaagtggacatttcg
cccccgcaggacgaacgcacgacaaacgtcgaccgggggataggctcggaggagagcaac
cagctcctcaacgggagcatgccgaagagtatccagagccaactgcacaagtctgctgac
tcggggggcaagcaagggaaggagcagaagctcaacccccccttgcactcgcccacctcc
aagcgaaagcgggtcaagttcaccacgttcaccacgatccctccggacgacagctgtcca
accatcaactccatcctcagctgcaacgaagatgacattaaatgggtttgccaagatatg
gatctcggggaaaccaaacactacatggagaagatcaaagagaaagcatag

DBGET integrated database retrieval system