KEGG   Gekko japonicus: 107108733Help
Entry
107108733         CDS       T04299                                 

Gene name
MTMR7
Definition
(RefSeq) myotubularin related protein 7
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
gja  Gekko japonicus
Pathway
gja00562  Inositol phosphate metabolism
gja01100  Metabolic pathways
gja04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107108733 (MTMR7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    107108733 (MTMR7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gja01009]
    107108733 (MTMR7)
Enzymes [BR:gja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     107108733 (MTMR7)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     107108733 (MTMR7)
Protein phosphatases and associated proteins [BR:gja01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    107108733 (MTMR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM Vps36_ESCRT-II Y_phosphatase DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 107108733
NCBI-ProteinID: XP_015264731
Position
Un
AA seq 609 aa AA seqDB search
SLPVXVENVRLIDGASSKRAALGTLYLTATHVIFVENESDARKETWVLHSQISSIEKQAT
AATGCPLLIRCKNFQNIQFIMPQERDCHDVYISLIRLARPVKYEELYCFSFNPKLNKEER
EQGWKLINLKEEYHRMGVPNNDWQLSDVNRDYRVCDSYPTEVYVPKSATAHIIVGSSKFR
SRRRFPALSYYYKTNNLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRSSLQKMLE
VCELRSPSMNDFLWGLENSGWLKHIKAIMDAGIFIAKAVAEEGVSVLVHCSDGWDRTSQV
CSIASLLLDPFYRTMKGFMVLIDKDWVSFGHKFNHRYGNLDGDPKEISPVIDQFIECVWQ
LMEQFPCAFEFNERFLVHIQHHIYSCQFGNFLCNNQKERRELKIQERTYSLWAHLWKNRA
DYMNPLYREDYNRTLNPQSAPWQFVYKFWSGMYNRFEKGLHPRQSVTEYLMAVKEETQQL
EEELVVLEERLAKLTKVRLDNGETTQQQNGINALQLSTSNDSIANTPQDYIGNLKSFPSR
STSQGDEEDSALILTQDNVKSSDPDLSANSDQESGVEDMSCRSPSGGSCLPSEDSAKDRD
SDDAVCLTV
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
tctctcccggtttaggtggaaaatgtccgcttaattgatggagcgtcttccaaacgggcg
gcgttaggaactctgtatctaactgctactcatgtaatctttgtggaaaacgaatctgat
gctcgtaaagagacatgggttcttcacagtcaaatctcctctattgagaagcaagctacg
gctgctactggttgccctttgctgattcgctgcaagaacttccagaacattcagtttatt
atgcctcaggaaagggactgtcatgatgtttacatatctctaatacgtctggcccgccca
gtgaaatatgaagaattgtactgtttttctttcaaccccaaattaaacaaagaagaacga
gaacaaggctggaagttgatcaacctaaaagaagaatatcatcggatgggggtcccaaat
aatgattggcagctcagtgatgtcaacagagattaccgagtatgtgactcataccccact
gaagtgtatgtgcccaaatctgccactgcccatatcattgtgggaagctctaaattccgg
agtaggaggcgtttcccagcactctcctactactacaagaccaataatctcaatgcaatg
gcaaacagagcagctgggaagggctacgaaaatgaagacaattactccaacatcaagttt
cagttcatcggcattgagaatatccatgtcatgaggagcagtctccaaaaaatgctagaa
gtttgtgagttgagatctccttcaatgaatgacttcctctggggactggagaattcaggc
tggctaaagcacatcaaagccatcatggacgctggcatcttcattgcaaaggccgtagcg
gaagaaggagtgagtgttctcgttcactgttctgatggatgggaccggacctctcaggtt
tgctctatcgcaagccttttgcttgatccgttttatagaactatgaagggatttatggta
ttaattgataaggattgggtttcatttggtcataaatttaaccacaggtatggcaactta
gacggcgacccaaaggagatctctccagttatcgaccagttcatcgaatgtgtgtggcaa
ctgatggaacaatttccttgtgcctttgaattcaacgaaaggttcctcgtccacatacag
caccacatctattcctgccagtttgggaattttctgtgcaacaatcagaaggagaggcga
gagctgaagattcaagaacggacgtattcactttgggctcatttgtggaagaaccgtgct
gattatatgaatcctctgtatagggaagactataacaggaccttgaatccacagtcggct
ccttggcagtttgtttataagttctggagtggaatgtacaaccgttttgaaaaaggtctg
catcctcggcaatctgtgacagaataccttatggcggtaaaggaagaaacacagcaatta
gaagaagagctggttgtcttagaagagagactggcaaagcttacaaaagtgcgattagat
aatggtgagacgacacagcaacaaaatggaatcaacgcgttacaactttctacctctaac
gacagcatagctaacacgccccaggattacattggtaatctgaagtcatttccctctcgg
agtacttctcagggagatgaagaagattcagctctgattcttacacaagataatgtgaaa
agctcggatccagatctttcagccaacagtgatcaggaatcaggtgtggaggatatgagc
tgccggtccccaagtggaggaagttgtttgcccagtgaagatagcgccaaagatcgtgat
tcagatgacgctgtttgtctcactgtctga

DBGET integrated database retrieval system