KEGG   Gekko japonicus: 107109446Help
Entry
107109446         CDS       T04299                                 

Gene name
GUCY1A3
Definition
(RefSeq) guanylate cyclase 1 soluble subunit alpha
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
gja  Gekko japonicus
Pathway
gja00230  Purine metabolism
gja01100  Metabolic pathways
gja04270  Vascular smooth muscle contraction
gja04540  Gap junction
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107109446 (GUCY1A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107109446 (GUCY1A3)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107109446 (GUCY1A3)
Enzymes [BR:gja01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107109446 (GUCY1A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 107109446
NCBI-ProteinID: XP_015265552
Position
Un
AA seq 687 aa AA seqDB search
MFCTKLKDLKITGECPFSLLSQSGVPDEHEEDCAEVPNSSKAALPICREKDTHGNLPQRK
TSRSKVYLHTLAESICKLIFPEHERLYLALQRTLSKHKIQEIRNSGEGEDFEKLISIHAN
ASGVPVSIIKKSLGEELFKICYEEDEHILGVVGGTLKDFLNSFSTLLKQSGHCQEAERKG
SLEEVSILCLEKDPDFLNVYYFFPKKTTSLILPGIIKAAAHILYETEVEVMLMPPCFCKD
STEFINQPYLLYSVQVTSAKPSLSPCKPQSSLVIPASMFCKTFPFHCMFDKDMAILQVGN
GIRRLLNRREFQTKPNFEEYFEILTPKINCTFSGIMTMLNMQFTIRVRRGGNILKKSTGV
MDLKGQMIYLFETCAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQARAQD
GLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPEEVAQQLWQGQVVQAKKFNNVTML
FSDIVGFTAICSQCSPMQVITMLNELYTRFDYQCGELDVYKVETIGDAYCVAGGLHKESD
THAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTL
ANKFESCSVARKINVSPTTYRLLKDYPGFMFTARSREELPPNFPSDIPGICYFLDAYLQG
ANSKACFQKKDAEDGKTNFLGTPTGVD
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgttttgtactaaactgaaagacctgaagatcactggtgagtgtcctttctctttactg
tcccaaagtggcgttccagatgaacatgaagaggattgcgcggaggtgccaaatagctcc
aaggctgccttgccaatctgcagagaaaaagatactcatgggaaccttccacaaagaaaa
accagcaggagcaaagtgtatctgcacactttagctgagagcatctgcaaacttatcttt
cctgagcatgaaaggttatatcttgcgctgcagagaacactatcaaaacataaaatacaa
gaaatcaggaactctggggaaggagaagattttgaaaagctgatcagtattcatgcaaat
gcatcaggagttccagtaagcattataaagaaatctcttggtgaagaacttttcaaaata
tgttatgaagaagatgaacacattctaggagttgttggggggaccctcaaagactttctg
aacagcttcagtactcttctaaagcagagtggccactgccaagaagccgagagaaaaggg
agcctggaggaggtctccatactgtgcttggaaaaagacccagatttcttaaatgtctac
tatttcttccctaagaaaacaactagcctcatcctccctggcattattaaagcagcagct
catattttgtatgaaacagaagtggaagtgatgctgatgcccccctgcttctgcaaagat
agcactgagttcattaatcaaccctatttgttgtattcagtccaagtcacgagtgcaaaa
ccatccttatcaccttgtaaacctcagtcatctcttgtgattcctgcttctatgttctgc
aagactttcccatttcactgcatgtttgacaaggacatggccattctacaagtcggcaat
ggtataagaagactgttaaacaggagggaatttcaaacaaagccaaactttgaggagtac
tttgaaatcctgacccccaaaataaactgcacatttagtgggatcatgacaatgctgaac
atgcagtttactataagagtgagaagagggggcaacattcttaaaaagtcgactggagtt
atggaccttaaaggacaaatgatctacctatttgagacctgtgctatcttgttcttggga
tccccctgtgttgacagactagaagattttacaggacgtggcttatatctttcagatatt
ccaattcataatgctttaagggatgttgttttaataggagagcaggccagagctcaagat
ggactcaagaaaaggttggggaagctcaaagctacccttgaacaggcacaccaagccctt
gaagaagagaaaaagaagacagtagatcttttgtgttccatttttcctgaggaggttgca
caacagctgtggcagggacaagttgtgcaagccaagaaatttaataatgtcacaatgctt
ttctctgacatcgtagggttcactgcaatctgttcccagtgctcacctatgcaggttatc
accatgcttaatgagctctacactcgctttgattaccaatgtggagaactggatgtctac
aaggtagaaaccattggggatgcttattgtgttgcgggaggcttgcacaaagaaagtgac
acccatgctgttcagatagcattaatggcactgaagatgatggagctgtcagatgaagtg
atgtctccacatggagaacccatcaagatgcggataggcctgcattctggatctgtcttt
gctggtgttgttggtgttaaaatgccacgatattgtctatttggaaacaacgtaacactt
gccaacaaatttgagtcttgcagtgttgcgaggaaaataaatgtcagcccaactacctac
aggttgctaaaggattacccagggtttatgtttactgctcgttcaagagaagaacttcct
cccaattttccaagtgatatccctgggatctgttactttcttgatgcttatcttcaagga
gcaaattcaaaggcctgctttcaaaagaaggatgccgaagatggaaaaacaaatttcttg
gggacaccaacaggtgtagattag

DBGET integrated database retrieval system