KEGG   Gekko japonicus: 107109642Help
Entry
107109642         CDS       T04299                                 

Gene name
PLK4
Definition
(RefSeq) polo like kinase 4
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
gja  Gekko japonicus
Pathway
gja04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107109642 (PLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107109642 (PLK4)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107109642 (PLK4)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     107109642 (PLK4)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   107109642 (PLK4)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107109642 (PLK4)
   Centrosome duplication proteins
    Regulators of centriole replication
     107109642 (PLK4)
  Sister chromatid separation proteins
   Polo kinases
    107109642 (PLK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Plk4_PB1 Plk4_PB2 POLO_box Pkinase_fungal Haspin_kinase Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 107109642
NCBI-ProteinID: XP_015265835
Position
Un
AA seq 970 aa AA seqDB search
MATCIGEKIEDFKVGNLLGKGSFAGVYRAVSLKTGLEVAIKMIDKKAMHKVGMVQRVQNE
VKIHCQLKHPSILELYNYFEDSNYVYLILEMCHNGEMSRYLKNKKKPFSEEEVRHFMHQI
ITGMLYLHSHGILHRDLTLSNLLLTNNMNIKIADFGLATQLRMPHEKHYTMCGTPNYISP
EIATRSAHGLESDVWSLGCMYYTLLVGKPPFDTDTVKNTLNKVVLADYEMPAFLSIEAQD
LIHQLLRKNPADRLSLSSVLDHPFMSKPNSARSKDLGTAEDSMDSGNATISTAFTTSSSV
NTSGCLKEKKRLLMGQPLPNKITVLPKTKNTSDVSSGDGSGSYNNWGLPVQELPNTGRGR
AVLLMEERPHSRYLRRAHSSERSGTSHSQNQRIPNNVGRCHSMETLSKPRTGLIENMKDF
SPTNSHGDIPAVFKEKLPAGSGSMEKHLSPPVKDQVCSNYLCLMKPSAGLLEPKSQAETM
QQWLGNMQPNAPVQELSYHNSVRKANGDFPFHLGVPQEMWKNAWNGLKVTKSQDGAQTAM
PAVGSLDGRKFTTGHLCKTEKSLPTPALDLHPVSETRKKWVEGQQYGHPKPLLRSIVSPL
NAHRLKPIRQKTKNAVVSILDTEEVYMEFLKEYGSQEFVKEVMRISCDGSGVTVYHPNEG
KGFPLKDRPPPPPEDLNIYSFDNLPEKYWKKYQYAAKFVQLVRSKTPKVTFYTRYAKCML
MENSPPADVEICFYDGAKIHKTAGVIRVIEKSGKAYTLKEESDLEKDVQIYVDHANEGHR
ICLAVESAVLAEERNESVPFFPIIVGRKPGNSESPKALLPPPAIPGTCPSLNDVASLKGN
SAARSKSPSQAPHPSMESYEGSAFKAAMTESNCLPTHQNECVVNSAQLLKSVFVKNIGWA
SQLTSGAVWIQFNDGSQLVAQAGVSSITYTSSDGHTVRYGENEKLPEYIREKLHCLSSIL
VMFTNEVGPH
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctgcatcggcgagaagattgaggatttcaaggtggggaacctgctggggaag
ggctcctttgcaggagtctacagagcagtgtccctgaaaacaggcttagaagtggctata
aaaatgattgacaaaaaggctatgcacaaagttggaatggtgcagagagttcaaaatgaa
gtgaagattcattgtcagctaaaacatccctctatacttgagttgtataattactttgaa
gacagcaactatgtgtatctgatattagagatgtgtcataatggagaaatgagcagatat
ttaaagaacaaaaagaagcctttctctgaagaagaagttcggcacttcatgcatcagatc
attacagggatgctataccttcattcccatggaatattgcatcgagacctaacactctct
aacctcttactcaccaacaatatgaacattaagattgctgattttggactagcaacccaa
ctgagaatgcctcatgaaaagcattacacaatgtgtgggacacccaattacatttctcca
gaaatagccacaagaagtgcacatggacttgaatctgatgtttggtctttgggatgtatg
tactatactcttctggttggaaagccaccttttgatactgatacagtaaagaacaccttg
aacaaagtggtattggcagattatgaaatgccagcatttttatcgatagaggctcaagac
cttattcatcagttacttcgcaaaaatccagcagatcgtttaagtctctcatctgttttg
gatcatccttttatgtctaagcctaactcagcgagaagtaaggatctgggaactgcggag
gattcaatggatagtggaaatgccactatttctacagcttttaccacatcctccagtgta
aatactagtggctgcttaaaggaaaagaaaagacttttaatgggccagccactccccaat
aaaattactgttcttcctaaaactaaaaacacgagcgatgtctcttctggggatggaagt
ggttcctataacaactggggacttccagtacaagaattacctaatactggtaggggaaga
gcagtgctactgatggaagaacgaccgcattcacgctacctcaggagggcacattcctct
gaaagatctggtacatcccatagccagaatcagagaataccaaataatgtggggagatgc
cattctatggaaaccctctcaaaacccagaacaggattaatagaaaacatgaaggatttc
tctcctacaaatagccatggtgatattcctgcagtgtttaaagaaaaacttccagctggt
tctggctcaatggaaaaacatctctctccacccgttaaagatcaagtttgttccaattat
ctctgcctaatgaagcccagtgctggcttattagaaccaaagtctcaagctgaaacaatg
cagcagtggcttggaaacatgcaaccaaatgctccagtgcaggaactttcatatcacaac
agtgttaggaaagcaaatggagatttcccatttcatcttggtgtgcctcaagaaatgtgg
aaaaatgcatggaatggcttaaaagtcacaaagtcacaggatggtgcacaaacagcaatg
ccagctgtggggtcactggatggaaggaaattcactactggacatctctgtaagactgaa
aagtccttgccaacacctgcactagatctccatccagtttctgaaaccagaaaaaaatgg
gttgaaggacaacaatatggccatccaaaacctttgcttcgaagtatcgtatctcctttg
aatgctcacaggttaaaaccaatcagacaaaaaacaaaaaatgcagtggttagtatttta
gatacggaagaagtttatatggaatttctaaaagaatatggttcccaagaatttgtaaaa
gaagttatgaggatctcttgtgatggaagtggggtcacagtttatcacccaaatgaagga
aaaggcttcccccttaaagaccgacctccacctcctcctgaagacttaaatatctatagc
tttgacaacttgccagagaaatactggaaaaaatatcagtatgcagccaaatttgtgcag
ttggtaagatccaaaacacccaaagttaccttctataccagatatgcgaagtgcatgttg
atggaaaactctcctcccgcagatgtggaaatttgtttttatgatggggcaaaaatacac
aagacagcaggtgtaattcgagtaatagaaaaatctgggaaagcctacaccctaaaagaa
gaaagtgatttagagaaggatgtgcaaatatatgtcgatcatgcaaatgagggtcatcga
atttgccttgcagtggaatctgctgttttggcggaagaaagaaatgaaagtgttccattt
ttccccattattgttggcagaaaaccaggaaattctgagtctccaaaggctttgctacca
cctcctgctataccaggtacttgcccttctttgaatgatgttgcttcactgaagggaaat
tctgctgccagatccaaatctcccagtcaagcacctcacccatctatggagtcatatgaa
ggatctgcatttaaagcagcaatgacggagtcaaactgcctacccactcaccaaaatgag
tgtgttgtaaattcagctcaactcctgaagtctgtctttgtaaaaaatattggttgggcc
tctcagctaacaagtggagctgtgtggattcagtttaatgatggatcccagttggtagct
caggctggcgtttcttccatcacatatacatcttcagatggtcatactgttcggtatgga
gaaaatgagaaattgcctgagtacattagagaaaagttgcattgtttatcttccattctg
gtgatgtttaccaatgaagtgggacctcactga

DBGET integrated database retrieval system