KEGG   Gekko japonicus: 107109993Help
Entry
107109993         CDS       T04299                                 

Gene name
BLVRA
Definition
(RefSeq) biliverdin reductase A
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
gja  Gekko japonicus
Pathway
gja00860  Porphyrin and chlorophyll metabolism
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    107109993 (BLVRA)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     107109993 (BLVRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biliv-reduc_cat GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 107109993
NCBI-ProteinID: XP_015266187
Position
Un
AA seq 260 aa AA seqDB search
MFGTVVVGVGIAGSVRIRDLLNPLSSSPAEHLKLVGFVSRRPLSDVQQANQISLQEALDN
QEVHAAVISTDNKNHEESIRMFLEAGKHVLVEYPMALSAKAAHQLWAMADQKGGPLDEER
SGFPAFSGIARLTWLVDLFGNLTVVSAAREEQKEKNYSRMTVQFQTANKRPLTWIEERAP
GMKRDKTVNFCFKSGCLESLPEAPRAAVGLFMQDLILFAKKLLGQVSKDELAAEKRRILR
CLDLADEIQAHCEQTPKIYS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcacggtggttgtcggggtggggatcgctggatctgtgcggatccgagacttg
ctgaatcctttgtcttccagccctgcagagcatctgaaactcgtgggcttcgtctcgagg
agaccactgagcgatgttcagcaagccaatcaaattagtttacaagaagctctcgacaac
caggaagtccatgctgccgtcatcagcaccgataacaaaaaccacgaggagagcatcagg
atgttcctggaggctggaaaacatgtcctcgtcgagtaccctatggcattgtctgcaaag
gcagcccatcagctctgggcgatggcagatcagaaaggcggcccgttggatgaagaacgt
tccgggtttccggccttcagcgggatcgctcgcctgacttggctggttgaccttttcggg
aacctcactgttgtgtctgccgcgagggaagaacagaaagagaagaactactccaggatg
accgtgcagtttcagacggcaaacaagaggcctctgacttggattgaagaaagggcgcca
ggaatgaaacgcgataagacggtcaacttctgtttcaaaagtggatgcttagaaagcctc
cccgaagccccccgtgcggcagtcggcctcttcatgcaagacctcatcctctttgccaaa
aaactcttgggccaggtttccaaagatgaactggctgcagaaaagaggcggattctgcga
tgccttgacctggctgacgaaattcaggctcactgtgagcagacacccaaaatctactct
tga

DBGET integrated database retrieval system