KEGG   Gekko japonicus: 107110095
Entry
107110095         CDS       T04299                                 

Gene name
TM7SF2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
gja  Gekko japonicus
Pathway
gja00100  Steroid biosynthesis
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    107110095 (TM7SF2)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     107110095 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 107110095
NCBI-ProteinID: XP_015266303
Position
Un
AA seq 419 aa
MDRHKIPRTKELEFGGVLGAACLLILLPATVFVLLLTCGTEQASLLNFTWPLPTLHSLWN
PQDFVLVLAWVGLQALLYMLPLGKVTEGTVLRDKSRLTYRINGIHAMWITALLVGVGMAA
GLRLSYIYDHLLQLAFSASVLAFGLSILLYLKALLAPGTGLAPGGNSGNPIYDFFIGHEL
NPRIGTFDLKFFCELRPGLLGWALINMGMLVKETELRGNPSLAMILVNAFQLLYVVDAFW
NEEAILTTMDIVHEGFGFMLAFGDLAWVPFLYSLQAYFLVTHPQKLSLPIAGGIILLNGL
GYSVFRSANSQKNTFRRNPADPKVAGLKTIPTATGRRLLVSGWWGLVRHPNYLGDLIMAF
AWSLPCGISHILPYFYVLYFTLLLIHREARDEHQCLRKYGLAWQEYCRRVPYRIFPYLY
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggatcgacacaagatcccccgcaccaaagaactggaattcgggggtgttctaggggct
gcctgcctcctcatcctgttgcctgccaccgtcttcgtcctgctactgacgtgtgggaca
gagcaggccagtctcttgaacttcacttggcctctgcccacgctccactccctatggaac
ccccaggactttgtgctggtcttagcctgggtagggctgcaggctctgctgtacatgctc
cctctggggaaggtcactgaagggactgttcttcgagacaagagccggctcacgtaccgt
attaacgggatacatgccatgtggatcacagcgttgttggtgggggtcggcatggctgca
gggttgcgcctcagttacatatacgaccatttgctacagctcgccttctctgcgtctgtt
cttgcttttggactcagcatcctcctctacctcaaagccctcctcgcccctgggacaggg
ctggctccaggcgggaattcaggaaaccccatttatgacttcttcataggccacgagttg
aacccacgcatcggtacctttgaccttaagtttttctgtgagctgcgcccgggtctcctt
ggatgggccctgatcaacatgggcatgttagtgaaggagacagagctgaggggaaatcct
tccttggccatgattcttgttaatgccttccagctgctctatgtagtggatgccttttgg
aatgaggaggccatcctcaccaccatggacatagttcatgagggttttggcttcatgctg
gctttcggggacctggcttgggtgcccttcctgtacagtctgcaggcctatttcctggtc
actcatccgcagaagctgagcctgcctatagctggaggcatcatcctgctaaatggcctt
ggctattctgtcttccgcagcgctaactcacagaagaacactttccgcaggaatccggct
gaccccaaagtagctggactcaaaaccatccccacagccactgggcggcgtctgctggta
tcaggctggtgggggcttgtgcggcaccccaactatctgggggacctcatcatggctttt
gcttggtccctgccctgcggcatcagccacatcctgccttatttctacgtcctctacttt
accttgcttctgatccaccgggaggccagggacgagcaccagtgcctgaggaagtacggc
ctggcctggcaggagtactgccgccgagtcccttaccggatcttcccatacctttactga

DBGET integrated database retrieval system