KEGG   Gekko japonicus: 107110247Help
Entry
107110247         CDS       T04299                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04060  Cytokine-cytokine receptor interaction
gja04068  FoxO signaling pathway
gja04110  Cell cycle
gja04218  Cellular senescence
gja04350  TGF-beta signaling pathway
gja04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107110247 (TGFB2)
   04350 TGF-beta signaling pathway
    107110247 (TGFB2)
   04068 FoxO signaling pathway
    107110247 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107110247 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107110247 (TGFB2)
   04218 Cellular senescence
    107110247 (TGFB2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107110247 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gja04052]
    107110247 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:gja00536]
    107110247 (TGFB2)
Cytokines and growth factors [BR:gja04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   107110247 (TGFB2)
Glycosaminoglycan binding proteins [BR:gja00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107110247 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 107110247
NCBI-ProteinID: XP_015266485
Position
Un
AA seq 411 aa AA seqDB search
MHCYLLSVFLTLDLATVAFALSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEEFPEP
EEVPPEVISIYNSTRDLLQEKANHRAATCEKERSEEEYYAKEVYKIDLPFFHSENKIPQK
SPQPSAYFRRVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVSEQRIELYQILKTKDLTS
PMQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHRDRNLGFKISLHCPCCTFVPSNNYII
PNQSEVLEASFAGLEDYHSAEKTLKSNRKKYSGKNPHLLLMLLPSYRLESQQSSRRKKRA
LDAAYCFRNVQDNCCLRPFYIDFKRDLGWKWIHEPKGYHANFCAGACPYLWSSDTQHSRV
LSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcactgctatcttctgagcgtcttcctcaccctggatcttgccacggtggcctttgcc
ttgtctacctgtagcaccctcgatatggatcagtttatgcgcaagaggatcgaagctatc
cgagggcagatcctgagcaaactgaaactcaccagccctccggaagagttcccggagccc
gaggaggttcccccggaggtcatttcaatctacaacagtacaagggacctgctgcaggag
aaagcgaaccacagagcggccacttgcgaaaaggagcggagcgaggaggaatattacgcc
aaagaagtttacaaaattgacctgccgtttttccattccgaaaacaagattccacaaaaa
tcaccgcaacccagcgcctattttagacgagtgagatttgacgtctcagcaatggagaaa
aatgcttccaacctcgtgaaggcagagtttagagtctttcgcttgcagaatccaaaggct
cgagtatctgaacagcggatagaattgtatcagattctcaaaaccaaagacctaacatca
ccaatgcaacgttacattgatagcaaggtagttaaaacaagagccgaaggtgaatggcta
tcttttgacgtaactgatgctgtacatgaatggctccatcatagagacagaaatcttgga
tttaagataagtttgcattgtccatgctgcacgttcgtgccttcaaataattatatcatc
ccaaaccaaagtgaagtgctagaagcaagttttgcaggtcttgaggactaccacagtgct
gagaaaactttaaagtccaataggaaaaaatacagtgggaagaacccacatcttctgcta
atgttgttaccctcctacagacttgagtcgcaacagtccagtcgacggaagaagcgtgct
ctagatgctgcctattgttttaggaatgtgcaggataactgctgcctgcgaccattttat
attgacttcaagagagatcttggatggaaatggatacatgaacctaaaggataccatgca
aatttctgtgcaggagcgtgtccctatttatggagctcagatactcagcacagtcgagta
ctcagcttgtataacaccataaacccagaagcatccgcatctccatgctgtgtatcccag
gacctagaacccctcaccatcttgtattacattggcaaaacgcccaaaattgaacagctt
tctaacatgattgtaaagtcgtgcaagtgcagctag

DBGET integrated database retrieval system