KEGG   Gekko japonicus: 107110298Help
Entry
107110298         CDS       T04299                                 

Gene name
NME7
Definition
(RefSeq) NME/NM23 family member 7
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
gja  Gekko japonicus
Pathway
gja00230  Purine metabolism
gja00240  Pyrimidine metabolism
gja00983  Drug metabolism - other enzymes
gja01100  Metabolic pathways
Module
gja_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
gja_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
gja_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107110298 (NME7)
   00240 Pyrimidine metabolism
    107110298 (NME7)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107110298 (NME7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gja04131]
    107110298 (NME7)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     107110298 (NME7)
Membrane trafficking [BR:gja04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    107110298 (NME7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK DUF1126 SAM_2
Motif
Other DBs
NCBI-GeneID: 107110298
NCBI-ProteinID: XP_015266545
Position
Un
AA seq 376 aa AA seqDB search
MSQDERFVFIAEWYDPNASLFRRYELLYYPKDGSVEMYDMKNRCRFLNRIKYEDLQFKDL
FVGNKITIFSRHLNLVDYGDQYTSRMLGSRKERTLALLKPDAALKLGEIIDMILNAGFTI
TKAKMMILSRKEAMDFHADHLAKPFYNELLEFITSGPVVALEILGDDAILKWKTLLGPAN
SAVARTDAPGSIRACFGSDGIRNVAHGPDSFATAARELELFFPSSGGRGPANTAKYTHCT
CCIIKPHAIKEGLTGKIIKAVIDTGFEISALKMFYMDRANAEEFYAIYKGVVAEYSEMVV
ELCSGPCIALEIRQMDPSKVFRDFCGPSDPEIARHLRPDTLRAIYGKNKIQNAVHCTDLP
EDGLLEVQYFFNILDN
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagatgaaagatttgttttcattgcagagtggtatgatccaaatgcttcactt
tttcgacgttatgagctcttgtactacccaaaagatggatctgttgagatgtatgacatg
aagaatcgctgtaggttcctgaatcgcataaaatatgaagatctgcaatttaaagatctg
tttgttggcaacaaaatcacaatcttttctcgccatctcaatttggttgactacggagat
cagtatacatctcgcatgttgggtagtcgcaaagaaagaaccttggctttattaaaacct
gatgcagccctcaagctcggggaaatcattgatatgattttgaatgctggttttacaata
actaaagcgaaaatgatgatattatcaaggaaagaagcaatggatttccatgcagaccac
cttgctaagccgttttacaatgagcttcttgagtttattacaagtggccctgttgttgct
ttagagatcttgggagatgatgcaatattaaaatggaaaactttattaggacctgcaaac
tcagctgtggcccgaactgatgctccaggcagcattagagcatgttttggaagtgacggc
ataagaaatgtggctcatggccctgactcttttgctactgctgcaagggaactggagtta
ttcttcccttctagcggaggccgtgggcctgcaaacactgcaaaatatacacactgtacc
tgttgtattattaaacctcatgcaattaaagaaggactgactgggaagattataaaagca
gtaattgatacaggatttgaaatctcagccttgaagatgttctacatggaccgtgcaaat
gcagaagaattctatgcgatttacaaaggtgttgttgctgaatattctgagatggttgta
gaactctgctcaggaccttgtatagctttagagatcagacaaatggatccctcaaaagta
ttcagagatttctgtggaccctctgatcctgaaatagcccgtcacctccgccctgacaca
cttcgtgctatctatggcaaaaacaagattcagaatgcagtccactgtacagatcttcca
gaagatggtcttttggaggtccagtactttttcaatatcctggacaactaa

DBGET integrated database retrieval system