KEGG   Gekko japonicus: 107110597Help
Entry
107110597         CDS       T04299                                 

Gene name
NPR2
Definition
(RefSeq) natriuretic peptide receptor 2
  KO
K12324  atrial natriuretic peptide receptor B [EC:4.6.1.2]
Organism
gja  Gekko japonicus
Pathway
gja00230  Purine metabolism
gja01100  Metabolic pathways
gja04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107110597 (NPR2)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107110597 (NPR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107110597 (NPR2)
Enzymes [BR:gja01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107110597 (NPR2)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   107110597 (NPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase ANF_receptor HNOBA DUF948
Motif
Other DBs
NCBI-GeneID: 107110597
NCBI-ProteinID: XP_015266883
Position
Un
AA seq 904 aa AA seqDB search
STWSDGTWDLAEVSCFWRSVVVRSSQTRGFAYFRPSYVLFWLRWSGARRLCTSPRPSQQP
SVHSSFATRDRSAAHLPIAPARCRHAVTAVHARFSAAVIIVAIAAAVLIIYICGPLEMLH
QIMRLAQCESMTNGDYVFFYVDVFGESLRAEGHRGAAKPWQSKDGPDPSALREAFQTVLV
ITYHEPQTPEYQHFQKQLILRARTEFGVELNASLKNLVAGCFHDALLLYTTVLNETLREG
GTKRDSSRILQKIKGRKFQGVTGTVSMDHNNDRETDFDVWAMANVETGEYQVVGHYVGSE
KQMNWLGPIHWKKGGPPLDNPPCVFDVDDPTCDKTPLSTLAIVALGAGLTFIMFGVSSFL
VFRKLMLEKELASMLWRIRWDELQFGSSERYHKGAGSRLPLSLRGSSYGSLMTAHGKYQI
FANTGVFKGNVVAIKHVNKKRIDLTRQVLFELKHMRDIQFNHLTRFIGACIDPPNICIVT
EYCPRGSLQDILENESINLDWMFRYSLINDLVKGMAFLHGSIIGHHGGLKSSNCVVDSRF
VLKITDYGLASFRQSSEGEGSHALYASELWTAPELLQNRPLPPPAMQKADVYSFGIILQE
IALRNGAFYVEGMDLSPKEIVQKVRNSQRPYFRPTVDTRVHSEELAVLMERCWAQELAER
PDFTQIKIFIRRFNKEGSTSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQ
ILPHSVAEQLKRGETVQAEAFDCVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAI
IDNFDVYKVETIGDAYMVVSGLPVRNGKMHAHEIVRMALALLEAVKTFRIRHRPNEQLHL
RIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEGEEDSSWGGGHPHLPLPQLAE
PAPL
NT seq 2716 nt NT seq  +upstreamnt  +downstreamnt
ttcgacttggtcagacgggacttgggacttggcggaagtgtcttgtttctggcgttcggt
ggtggtgcgctcttcccagacgcgcggcttcgcctacttccggcccagctatgtcctttt
ctggctccgctggtctggtgctcggcgcctgtgcacgtcccctcgtccttctcagcagcc
gtcggtgcactcctccttcgccaccagggatcgctctgccgcgcacctcccgatcgcgcc
cgctcgctgccgccacgccgtcactgccgtccacgccaggttctccgccgccgtcatcat
tgtcgccattgccgccgccgtcctcatcatctacatctgtgggccactggagatgctgca
ccagatcatgcgcctggcccagtgtgagagcatgaccaacggggactacgtcttcttcta
cgtggacgtttttggggaaagcctgcgtgccgaggggcatcggggggcagccaagccctg
gcagagcaaggacggcccagacccaagtgccctccgggaggccttccagacggtgctggt
gatcacatatcatgagccccaaacccccgagtaccagcatttccagaagcagctgatcct
gcgtgcccggacagagtttggcgtggagctcaacgcctcgctgaagaacttggtggccgg
ctgcttccacgacgcgctcctcctctacaccaccgtgctgaatgagacgctgcgcgaagg
cgggactaagcgtgactccagccgcatcctccagaagatcaagggccggaaattccaggg
cgtcactgggaccgtgagcatggaccacaacaatgaccgggaaacggacttcgatgtgtg
ggccatggcgaacgtggagacgggagaataccaggtggtgggccattacgtgggatcaga
gaagcagatgaactggctggggcccatccactggaagaagggggggcctcctctcgacaa
cccgccctgtgtctttgacgtggacgaccccacctgtgataaaactccgctctccacctt
ggccatcgtggcgctgggagccgggctcaccttcatcatgtttggagtgtccagcttcct
ggtcttcaggaagctgatgctggagaaggagctggcgagcatgctctggcgcatccgctg
ggacgagctgcagtttgggagttccgagcgctaccacaagggggcgggcagccgccttcc
cctctctctgcgtgggtctagttatggctccctgatgacagcccatgggaaataccagat
ctttgccaacaccggcgtcttcaagggaaacgtcgtggccatcaaacacgtcaacaagaa
gcggattgatctgacgaggcaggtgctcttcgaactcaaacacatgcgagacatccagtt
caaccacctgacacggttcatcggggcctgcatcgacccccccaacatctgcatcgtgac
cgagtactgcccccggggcagcttacaggacattctggagaacgagagcatcaacctgga
ctggatgttccgctactctctcatcaacgaccttgtcaagggcatggcgttcctgcacgg
cagcatcatcgggcaccacgggggcctcaagtcctccaactgcgtggtggacagccgctt
tgtgctcaagatcaccgactacggcctggccagcttccgccagagcagcgagggggaggg
gagccacgccctctatgccagtgagctgtggacagccccggagctcctgcagaacaggcc
cctgccccctccggccatgcagaaggccgacgtctacagcttcgggatcatcctccaaga
gatcgccctgcgcaacggggccttctacgtggagggcatggacctcagccccaaagagat
tgtgcagaaggtgcgcaacagccagaggccgtacttccgccccaccgtcgacacgcgggt
gcacagcgaggagctggcggtgctgatggagcgctgctgggcccaggagctggccgagcg
ccccgacttcacccagatcaagatcttcatccggcggttcaacaaggagggcagcaccag
catcctggacaacctgctctcccgcatggagcagtacgccaacaacctggagaagctggt
ggaggagcgcacccaggcctacctggaggagaagcgcaaggcggagaacttgctctacca
gatcctgccccactccgtggcggagcagctcaagcgcggcgagacggtgcaagcggaggc
ctttgactgcgtcaccatctacttcagcgacatcgtgggcttcacttccctgtcggctga
gagcacccccatgcaggtggtgaccctcctcaacgacctctacacctgctttgatgccat
catcgacaacttcgatgtctacaaggtggagaccattggcgacgcctacatggtggtgtc
ggggctgcctgtccgcaacggcaagatgcacgcccacgagatcgtccgcatggccctggc
cctcctggaggccgtgaagacgttccgcatccggcaccggccgaacgagcagctccactt
gcggatcggcatccactcagggccggtgtgcgccggagtggtgggtctcaagatgcctcg
gtattgcctctttggggacacggtcaacacagcctcccgcatggagtccaacggcgaggg
tgaggaggactcttcctggggagggggccacccccacctgcctcttccccagctggccga
gccggcccctctgtaa

DBGET integrated database retrieval system