KEGG   Gekko japonicus: 107111682Help
Entry
107111682         CDS       T04299                                 

Gene name
TSPAN12
Definition
(RefSeq) tetraspanin 12
  KO
K17355  tetraspanin-12
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    107111682 (TSPAN12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 107111682
NCBI-ProteinID: XP_015268174
Position
Un
AA seq 305 aa AA seqDB search
MAREDSVKCLRCLLYALNLLFWLMSITVLAVSAWMRDYLNNVLTLTAETRVEEAVVSTYF
PVVHPVMIAVCCFLIIVGMLGYCGTVKRNLLLLVWYFGSLLVIFCVELACGVWTYEQEIT
VHVQWSDMVTLKSRMTNYGLPRYQWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDS
CCVREFPGCSKQAHQEDLSDLYQEGCGKKMYTFLRGTKQLQVLRFLGISIGVTQILAMIL
TITLLWALYYDRRDPGTDQMLSLKNDTAQHLSCHSVELLKPSLTRIFEHTSVANSFNTHF
EMEEL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggccagagaggactcggtgaagtgtttgcgctgcctgctctatgcccttaatctgctc
ttctggttgatgtccatcacagtgttagcagtttctgcctggatgagggactatctgaat
aatgttctcactctaactgcagaaacaagggtagaggaagctgttgtttccacttatttt
cctgtagttcatccagtcatgattgcagtctgctgcttcctgattattgtcgggatgttg
gggtattgtggaacagtaaaaagaaatcttttgctgcttgtatggtattttggaagtttg
cttgtgatattctgtgttgaactggcatgtggagtttggacctatgaacaagaaattacg
gttcatgtgcaatggtcagacatggttactttaaaatccagaatgaccaattatggctta
cccagatatcagtggcttactcatgcctggaatttctttcagagagagtttaaatgctgt
ggagtagtttacttcactgactggttggaaatgacagaaatggattggcctcctgattct
tgttgcgtaagagagttcccaggatgctcaaagcaggcccaccaagaggatcttagtgac
ctttatcaggagggttgtggtaaaaagatgtacactttcttgaggggaaccaagcaactg
caggtgctccgatttcttggaatctctattggggttacccaaattctggctatgattctt
actattactttgctgtgggctctatattacgaccgacgggatccagggacagatcagatg
ctgtccttgaagaatgacaccgcccagcacctgtcatgtcattcagtggagctgctgaaa
cccagcctgacgaggatcttcgagcacacatccgtggcaaacagctttaacacacacttt
gaaatggaggagctgtag

DBGET integrated database retrieval system