KEGG   Gekko japonicus: 107111762Help
Entry
107111762         CDS       T04299                                 

Gene name
MAK
Definition
(RefSeq) male germ cell associated kinase
  KO
K08829  male germ cell-associated kinase [EC:2.7.11.22]
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107111762 (MAK)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     107111762 (MAK)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: CMGC group
  RCK family [OT]
   107111762 (MAK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 107111762
NCBI-ProteinID: XP_015268274
Position
Un
AA seq 612 aa AA seqDB search
MNRYTTMKQLGDGTYGSVLMGKSNETGELVAIKRMKRKFYSWDECMNLREVKSLKKLNHA
NVIKLKEVIRENDHLYFVFEYMKENLYQLMKDRNKLFPESVIRNIMYQILQGLAFIHKHG
FFHRDMKPENLLCMGPELVKIADFGLARELRSQPPYTDYVSTRWYRAPEVLLRSSVYSSP
IDIWAVGSIMAELYTLRPLFPGTSEVDEIFKICQVLGTPKKNDWPEGYQLAAAMNFRFPQ
CVSINLKTLIPNASNEAIQLMNEMLNWDPKRRPTASRALKLPYFQVGQVLGPPPQYLDQK
QPHSKLIQPTEPKPSLSKLEPLSKLESISKPESQMSPNAPDRFQLQPLLKNNSQPLQPIQ
LPQNSTNQQPSKQQQSFFPAINKNASPKQTAIGPSNGAVGLKNCRRRWGQTVLKTMDSWD
DFEDAEFGISYSKKPSIATVNEKKTKESLFSVPKSPTSGPPGGENKVLKRNDSGISTTSA
KQYYLKQSRYIPGAANKEGCHGTWNNSVFSKPLAPVGGLSFSRVSAGNAGFVGAAYNAPG
GYIPSFHKNEVGSAGQRIQLAPLGPSATAGRAQLPGTTYNPATKGINILTRPQPVQPVHG
RTDWMAKYGGHR
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgttatacaactatgaaacaacttggagatggaacgtatggcagtgtgttgatg
gggaagagcaacgaaacaggggagcttgtggccatcaagagaatgaaaaggaagttctac
tcgtgggatgaatgtatgaatttgagagaagtcaagtcactgaagaaactgaatcatgcc
aatgtgataaagctaaaagaagttatccgagaaaatgatcatctttattttgtgtttgag
tatatgaaagaaaatttgtatcaattaatgaaggacagaaataagttgttcccagagtct
gtcatcagaaacattatgtatcagatattgcaaggactagcttttatccataaacatggt
tttttccaccgggatatgaagccagaaaacctgctctgtatgggtccagaacttgttaaa
atagctgattttggactggctagagagctaagatctcagcccccatatactgattatgtt
tctaccaggtggtatcgggcacctgaggttttgctgagatcttcggtttatagttcccct
attgatatatgggcggttggcagcataatggctgaactatatacattaagaccccttttc
ccgggaacaagtgaagttgatgaaatcttcaaaatttgccaagtgttaggaaccccaaag
aagaacgattggccagaagggtaccagcttgcggcggcgatgaacttccgcttcccccag
tgcgtctccataaacttaaagactctaatcccaaatgctagcaatgaagcgatccagctt
atgaatgaaatgctgaactgggatccaaagagacgaccgacagcaagtcgggcgctgaag
ttgccctacttccaagttggccaagttttaggaccacctccgcaatatctggaccagaaa
cagccacattctaagttaatccagccgacagagccaaagccatctctatccaagctagaa
cctctatcaaaattagaatcgatatctaagccagaatctcagatgtcaccaaatgcgcct
gacagatttcagctgcagcctctactgaagaataactcacagcccctccagccaattcag
ctcccacagaactcaaccaaccagcaaccgtcaaagcaacagcaatcgttctttccagcc
atcaataaaaacgcatcaccaaagcaaacagccataggaccttcaaatggggcagtgggc
ctgaaaaattgtcggcgacgatggggtcagactgtattaaagactatggatagttgggat
gattttgaggatgcagaatttggaatttcgtattctaagaaacccagcattgcaacagtg
aatgaaaagaaaacaaaggaatctctctttagtgttcctaaatcccctacatcaggccca
ccaggtggagaaaacaaagttctgaagagaaatgactctgggatatctactacatcagcg
aaacagtactaccttaagcagtcaagatacatacctggagcagccaataaagaaggatgc
catggaacctggaacaattctgtgttttcaaaaccgctcgcacctgttggaggtctgtcg
ttcagccgagtcagtgcaggaaatgctggctttgtaggtgctgcctacaatgcccctgga
ggctatatcccttcctttcacaaaaacgaagttggttcagctggtcagaggatacagctg
gcaccgcttgggccatcagccacagccggccgtgctcagttaccagggactacttacaac
ccagccaccaaaggcattaacatcttgactcggccccagcccgtacagccagtacacgga
agaacagattggatggccaagtatggaggacatcggtag

DBGET integrated database retrieval system