KEGG   Gekko japonicus: 107111801Help
Entry
107111801         CDS       T04299                                 

Gene name
CPT1A
Definition
(RefSeq) carnitine palmitoyltransferase 1A
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
gja  Gekko japonicus
Pathway
gja00071  Fatty acid degradation
gja01212  Fatty acid metabolism
gja03320  PPAR signaling pathway
gja04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107111801 (CPT1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107111801 (CPT1A)
   03320 PPAR signaling pathway
    107111801 (CPT1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gja03029]
    107111801 (CPT1A)
Enzymes [BR:gja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     107111801 (CPT1A)
Mitochondrial biogenesis [BR:gja03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    107111801 (CPT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 107111801
NCBI-ProteinID: XP_015268319
Position
Un
AA seq 770 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLRMSHEALRQIYLSGLYSWKKKYIRLKNGIITGVYPASPS
SWLIVVVGVMSTMYAKMDPSLGLIAKINRTLDTTGYMSHQTQNVVSGILFGTGLWVALIF
TMRYTLKMLLSYHGWMFHEHGKLSTGTMIWMKLVKLFSGPKPMLYSFQTSLPRLPVPAVK
DTVNRYLESVKPLMNDEEFRRMEDLGKDFAVNLGPKLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPIMVNSNYFAMDFLYFTPTSVQAARAGNAIHAILLYRRKLDRQQIPPTLLMGST
VPLCSAQWERMFNTSRIPGEETDTIQHIKDSKHLVVYHKGCYYKVWLYYDGRLLAPREIE
HQMQWILNDKSEPQPGEEKLAALTAGDRVPWAKARQTYFARGKNKQSLDAIEKAAFFVTL
DDTVQGYREEDPVISMDAYAKALLHGKCYDRWFDKSFTFIVFRNGKMGLNAEHSWADAPV
MGHLWENVMFSDCLELGYTEDGHCKGEISSGIPMPTRLQWEIPEECQEVIERSLEIARPL
ADDVDFHCFPFDTFGKGLMKKTKTSPDAFVQLALQLAHYRDMGKFCLTYEASMTRLFREG
RTETVRSCTVESCKFVQAMDDPAESTEKKCVLFKAAAAKHQFLYRFAMTGAGIDRHLFCL
YVVSKYLAVESPFLKEVLAEPWRLSTSQTPQQHIDLNKNPEMESSGGGFGPVADDGYGVS
YIIVGENLINFHVSSKFSCPETDSHRFGSNIKQALCDIRNLFHLGKNSTK
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcacatcaagcggtcgcttttcagttcactgtaactccagatgggattgat
ctgcgcatgagccatgaagcactcaggcagatctatctgtctgggctctattcctggaag
aagaagtacatcagactcaagaatggtataatcacaggagtctatccagccagcccatcc
agttggcttattgtagtggtgggagttatgtcaacaatgtatgccaaaatggatccttca
ttgggcttaatagcaaaaattaacaggactcttgacacaaccggctacatgtcccatcaa
acgcagaatgttgtcagtgggattctttttgggacagggctttgggtggcccttattttc
acaatgcgctatactctaaagatgctgctttcctaccatgggtggatgtttcatgaacat
ggcaaactttccacaggaaccatgatatggatgaaactggtaaaacttttctcaggtcct
aaaccaatgctgtacagtttccagacgtctctgccgcgccttcctgttccagctgttaag
gacacagtaaataggtacttggagtcagttaagccacttatgaatgatgaagagtttaga
agaatggaagatcttggcaaagattttgcggttaatttgggaccaaaactacagtggtac
ttgaaactgaaatcctggtgggctacaaactatgttagtgattggtgggaagaatacatt
taccttagaggacgtggcccaattatggttaacagtaactattttgcaatggatttccta
tattttactcccacctctgtgcaggcagctagagctggcaatgccatccatgcaatcttg
ctgtatagaagaaaacttgacaggcaacaaatcccaccaactcttctgatgggatccaca
gttccactctgctcagctcaatgggagaggatgtttaatacctcccgtattccaggagaa
gaaacagatactatccagcacataaaagacagcaagcacctcgttgtgtaccataaagga
tgctactacaaagtatggctgtactatgatggcagactactggctccccgggagattgaa
caccagatgcagtggattttaaatgacaaatcagagccccagcctggtgaagaaaagtta
gcagctcttactgcgggagatagagtaccttgggccaaggcgcgccagacatactttgcc
cgtggaaagaacaagcagtccttggatgccattgaaaaggcagctttctttgttactttg
gatgacactgttcagggttacagggaagaggatccagtgatatcaatggatgcctatgca
aaggcacttctgcatggcaagtgctatgacaggtggtttgacaagtcatttactttcata
gtgttcaggaatggtaaaatgggcttgaatgctgaacactcctgggcagatgctcctgtt
atggggcatctttgggagaatgtcatgttttccgactgtcttgaattgggctatacagaa
gatggccattgcaaaggagaaatcagttcaggcattcctatgcctaccaggctacagtgg
gaaattcctgaagagtgccaagaagtgatagagaggtccctggaaattgcaaggccatta
gcggatgatgtggacttccactgttttccttttgacacatttgggaaaggattaatgaag
aaaacaaaaactagtcctgatgcttttgtgcaacttgcccttcagcttgctcactaccgg
gacatgggaaaattctgcttaacttatgaagcatctatgacccgtctcttcagagaaggt
agaacagaaacagttcgctcatgtactgttgagtcctgcaagtttgtgcaagctatggat
gacccagcagaaagtactgaaaagaagtgtgtgctgttcaaggccgctgctgctaaacac
cagtttttgtaccgttttgccatgactggtgctggtattgatcgtcacctcttctgtctt
tatgtggtgtctaaataccttgctgttgaatctcctttccttaaggaagtcttggcagag
ccctggagactttcaacaagtcagacaccgcaacagcacattgacctgaacaagaatcct
gaaatggagtccagcggtggtggctttggaccagttgctgatgatggttacggtgtgtca
tatattatcgtgggtgagaatctcatcaatttccatgtatccagcaagttttcttgccca
gaaacagattctcatcgctttggaagcaacatcaagcaggctttgtgtgacatcagaaat
ttgttccatcttggtaaaaactctactaagtga

DBGET integrated database retrieval system