KEGG   Gekko japonicus: 107111964Help
Entry
107111964         CDS       T04299                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gja01002]
    107111964
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gja04147]
    107111964
Enzymes [BR:gja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107111964
Peptidases [BR:gja01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   107111964
Exosome [BR:gja04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   107111964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Thioesterase Peptidase_S9 Peptidase_S15 Abhydrolase_2 Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 107111964
NCBI-ProteinID: XP_015268498
Position
Un
AA seq 397 aa AA seqDB search
MRKRNESVTLEHERFATSAPAAASSPSQSTQLDKGFSLRPSLRLPGSAHPAGDSGMKRPL
GRRHGMWFRLRKLVIWLLGVYIAIPFIVKLCPGVQAKLIFLNFVRAPYFIDLKRPQDQGL
NHTCNYYLQPEEGVTIGVWHTVPAGLWKDAQGKDQPWYEDALGSSSPVILYLHGNGGTRG
GEHRVELYKVLSSFGYHVVTFDYRGWGDSVGSPSESGLTYDALHVFDWIKARSGDNPVYI
WGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEARSHPFSVIYRYFPGFDWFFL
DPITSSGIKFANDENVKHISCSLLILHAEDDPVVPFHLGKKLYNIAAPSRNFRDHKVQFI
PFHTDLGYRHKYIYKSPELPRILREFLGKIEHEHHRH
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagaggaacgagtccgttacgttggagcatgagcgctttgccacttcggcaccg
gctgccgcttcctctccttcccaatccacgcagttggacaagggcttcagcctgagaccg
agcctgcgtctgcctggcagcgcccaccccgccggagactccggcatgaagcgaccgctt
ggcaggagacatggaatgtggtttcgattgcggaagctagtaatctggttgttgggagta
tacatagccattccatttatagtaaaactttgtcctggtgttcaggcaaagctcatcttc
ctaaattttgtgagggcaccctacttcattgacttgaaaaggccccaggatcaaggttta
aaccacacctgtaactactacctacagccagaggagggtgtaacaattggagtctggcac
acagttcctgcaggtttgtggaaggatgctcaaggaaaggaccaaccatggtatgaggat
gcattgggttctagtagccctgtaatcctgtacttgcatggaaatggaggtacaagagga
ggggaacaccgtgtggaactttacaaggttctgagttcttttggttaccatgtagtcaca
tttgattatcgaggctggggagactcagtaggcagtccttcagaaagcggactgacttat
gatgctcttcatgtttttgactggataaaagcacgaagtggagacaatccagtttatata
tgggggcactccttgggcactggagttgcaaccaacctagtgaggcgtctctgcgaaaga
gaaactcctccagatgctctgatactagagtccccttttacaaatatacgtgaggaagca
agaagccatcccttttcagtgatatatagatacttcccaggatttgattggtttttcctt
gacccgatcacctctagtggaattaaatttgcaaatgatgaaaatgtgaagcatatttca
tgctctctgcttattcttcatgctgaagatgatccagttgtgccgtttcatcttggaaag
aagctctacaatattgctgccccatctcggaatttccgtgatcacaaagtgcagttcatt
ccatttcatacagacctaggctacaggcataaatatatctacaagagtccagaactacct
cgaatattacgggaattcctgggaaaaattgaacatgagcatcatcgtcactga

DBGET integrated database retrieval system