KEGG   Gekko japonicus: 107112613Help
Entry
107112613         CDS       T04299                                 

Gene name
PHYKPL
Definition
(RefSeq) 5-phosphohydroxy-L-lysine phospho-lyase
  KO
K18202  5-phosphonooxy-L-lysine phospho-lyase [EC:4.2.3.134]
Organism
gja  Gekko japonicus
Pathway
gja00310  Lysine degradation
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107112613 (PHYKPL)
Enzymes [BR:gja01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.134  5-phosphonooxy-L-lysine phospho-lyase
     107112613 (PHYKPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 107112613
NCBI-ProteinID: XP_015269281
Position
Un
AA seq 440 aa AA seqDB search
MKAEPRCRLETLALRKQLIGSSCRLFFPEDPVKITRAKGQYMYDENGNKYLDCINNVAHV
GHCHPEVIRAAHQQNQLLNTNSRYLHDNLVDYAQRLSNTLPEKLCTFYFLNSGSEANDLA
LRLARQYTKHEDVVVIDHAYHGHLTSLIDISPYKFRNLDGQKEWVHVVPLPDTYRGLFRE
DHKDPASAYASEVKKIIDQGHQKNRKFAAFFAESLPSVAGQIIPPPGYFQKVAEHIHKAG
GVFIADEIQVGFGRVGKHFWAFQLQEDFIPDIVTMGKPIGNGHPVSCVATTRDIAEAFSA
TGVEYFNTFGGNPVSCAIGIAVLDVIEKEQLQDHALQVGSFLMELLHQQKEKHPLIGDVR
GAGLFIGVDLVQDQTERSPATKEAELITTRLKEEFIMLSTDGPGRNVLKFKPPLCFNTKD
AQLVVDKLDKILTELEMGNT
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgagccacgttgccgcctagagactctggctttgaggaagcagttaatcgga
tcctcctgcaggctttttttcccagaagacccagtgaaaattaccagagcaaagggccag
tatatgtacgatgaaaatggaaataagtatcttgactgtataaataatgttgctcatgtt
ggtcactgccatcctgaggtaatccgtgcagcacatcaacaaaaccagttgttaaataca
aactctcggtatctacatgacaacttggtagattatgcacaaagactttcaaatacattg
cctgaaaagctgtgcactttctattttttgaattcaggatcagaggccaacgaccttgcc
ctgagactggctcggcagtacacaaagcatgaggatgttgttgtaatagatcatgcttat
catggacatctgacatccttgattgacataagtccatataaattcagaaatctagacggc
caaaaggaatgggtccatgtggttcctcttcccgatacataccgaggattgtttagagaa
gatcacaaggatccagcctcagcgtatgccagtgaagtgaaaaaaataattgatcaagga
caccaaaaaaacaggaagtttgcagcatttttcgccgaatctttaccaagtgttgctgga
caaatcattccaccaccaggttatttccagaaggtggcagagcatatacacaaggcagga
ggtgtgttcattgcggatgaaattcaagttggctttgggagagttggtaaacatttttgg
gcatttcaacttcaggaagattttatccctgatattgtcactatgggaaaaccaattggc
aacggacatcctgtctcctgtgtggcaacaactagggacattgcagaggcattttcagca
acaggagtagaatattttaacacatttggaggaaatcctgtgtcctgtgcaataggtata
gcagttttggatgtcattgaaaaggagcagcttcaagaccatgctcttcaagtgggaagc
ttcctcatggaactactccatcaacaaaaagaaaagcatcctctaattggcgatgtcagg
ggtgctggattgttcattggagtagatttggtacaagaccaaactgaaagatcacctgct
accaaagaagctgagttgataacaacaaggttgaaggaagaattcattatgctgagcact
gatggcccaggaaggaatgtgcttaaattcaaacccccgctatgttttaatacaaaagat
gcacagcttgttgtggacaagcttgataagatattaacagaattagagatgggaaatacc
tag

DBGET integrated database retrieval system