KEGG   Gekko japonicus: 107112671
Entry
107112671         CDS       T04299                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gja03036]
    107112671 (ANKRD53)
Chromosome and associated proteins [BR:gja03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    107112671 (ANKRD53)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 107112671
NCBI-ProteinID: XP_015269351
Position
Un
AA seq 484 aa
MAAPKREGILRGPSGAPSRHAITFAKGSPSVVQRPVIDGRGSIKPVVWKDELYAASTGEV
NWLQMCLQKTESPTQADINGFSALHTSALFGRLDCLKMLVEKYGVSVDLASLTGWRPIHL
VMNKESENRALECLQYLIGKEADVNVQNQNGISPLHKAASEGRTDCVKVLIEAGADVHAK
DTEGQEPIDLCRMWGHRGCSKYLASAMWKIDKQNLAREVRRLDEIKKECQAKEEESLRRR
QMELNHFNNLVFFEWLERKRLPPPSARILSFLEKRAQSVTLRKPHGRQDSVAPPPSSPGG
IGFFDAFEKDWRRRAWNTSANPASLPATRLSRPDTVRLGVSPEPSVDHDFSAFLFLVEDG
YGEAEIRIGKCGEAFPMPALPWETIQRSLYPHAWPSRLRVPQDLRPHHIWDVKRKRPPGP
EHRWTDQMALSLRQTLDPAFLAALKAHLATYSDAEVLPGGLDSDWGDRKERASPSLGSGS
GRSH
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggcggccccgaagcgcgaagggatcctgcgcgggccctctggcgccccgtcccgccat
gccatcactttcgccaaaggcagccccagcgtcgtccagaggccagtgattgacgggagg
ggatcaatcaaacctgtcgtgtggaaggatgaactctacgctgccagcaccggagaagtc
aactggctccaaatgtgtctgcaaaaaactgaaagtcccacccaggccgatattaatggt
ttctctgcactgcatacatctgcccttttcggccggctggactgtctcaaaatgctggtg
gagaagtatggggtcagcgtagacttggccagcctgacgggctggcggcccatccacctg
gtcatgaacaaggagagcgagaaccgtgcgctggagtgcctccagtacctgatcggcaaa
gaggccgacgtcaatgtacagaaccaaaacggaatctcgcctctccacaaggccgccagt
gaaggccgaaccgattgcgtcaaggtcctgattgaggccggggcagacgtccacgccaag
gacaccgaaggtcaagagcccatcgacctctgcagaatgtggggccacagagggtgctcc
aaatatctcgcttctgccatgtggaagatagacaagcagaatcttgcgcgggaggtcagg
cggctggatgagatcaagaaagagtgccaagcgaaggaggaagagtccttgagaagacgg
cagatggagctgaatcactttaacaacttggtgtttttcgaatggctggaaaggaagcgt
ctgcctcccccctctgcccggatcctgagcttcctggagaagcgggcccagtcggtcacc
ctccgcaagccgcacgggagacaggacagcgttgccccccctccgagcagcccggggggg
ataggcttctttgacgccttcgaaaaggactggcggcgccgtgcctggaacacgagcgcc
aaccccgcctccctgccggcgacccgcctctcccgccccgacacggtccgcctgggggtc
agcccggagccttccgtggaccacgacttcagcgccttcctcttcctcgtcgaagacggg
tacggagaggccgagatccggatcggcaagtgcggcgaggccttccccatgcccgccctg
ccctgggaaaccatccagaggagcctgtacccccacgcctggccctcccgcctgagggtc
ccgcaggacctcaggccccaccacatctgggacgtgaagaggaagcggccccccgggccg
gagcaccgctggacggaccagatggccctgagcctgcggcagacgctcgaccccgccttc
ctggccgccctgaaggcccacctggccacctacagtgacgcggaggtgcttcccgggggg
ctggattcggactggggagaccgcaaagagcgcgccagtccgagcctcggcagcggcagc
ggccgcagccactga

DBGET integrated database retrieval system