KEGG   Gekko japonicus: 107113317Help
Entry
107113317         CDS       T04299                                 

Gene name
CDK15
Definition
(RefSeq) cyclin dependent kinase 15
  KO
K15594  cyclin-dependent kinase 15 [EC:2.7.11.22]
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gja01001]
    107113317 (CDK15)
Enzymes [BR:gja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     107113317 (CDK15)
Protein kinases [BR:gja01001]
 Serine/threonine kinases: CMGC group
  CDK family
   107113317 (CDK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 107113317
NCBI-ProteinID: XP_015270120
Position
Un
AA seq 375 aa AA seqDB search
MLQVKKGGSVKQRRFSAPSQEQDFAERVQWQRKVLPFGNATSYLKLEKLNEGSHSTVYKG
ISRIYGQLVALKVIRLKTEEGVPFTTIREASLLKGLKHANIVLLHDIIQTKETLTLVFEY
MDTDLAQYMSQHPGGIHLHNAMLFMFQLLRALAYIHQHHILHRDLKPPNLLLSCLGELKL
ADFGLARAKSIPSQTYSAEVVTLGYRPPEVLLGATEYSSEVDIWGAGCIFVEMLQGQPLF
PGVRNTFEQLEEIWEILGVPTEETWPGVSKLYHYRPECFPLLLQGWLFLLYPRLGWESGV
EDLAARMLKVCPRDRISAQEALVHHFFSSLPSQLYQLSDPQSVFVVPGVKLKPEICDLFA
PYQKDHHPISSSKFW
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgctccaggttaaaaaaggtggaagcgtaaagcaacgccgtttcagcgccccatctcag
gagcaggattttgctgagagagtccagtggcaaagaaaggtgctcccatttggaaatgct
acatcctacttgaaacttgagaagctgaatgaaggttctcactctacagtgtacaagggg
atcagcaggatatacggccagctggtagcactgaaagtcatccgactgaagactgaggaa
ggagtgccttttacgactataagagaagcatccctcctcaagggcctaaagcacgccaat
attgtgctgctgcacgatatcatccagacgaaggagaccctgacgttggtttttgagtat
atggacacagacttggcacagtatatgtcccagcatccagggggaattcatcttcacaat
gccatgctctttatgttccaacttctgagagccctggcttacatccatcaacaccacatc
cttcaccgagacctgaaacctccaaacttgctcctcagttgccttggagagctcaagtta
gccgactttggtcttgctcgcgccaagtccattcccagtcagacctactctgctgaggtg
gtgacgctgggatatcggcctcccgaggtgctgctgggagccacggagtattcttctgag
gtggatatctggggtgcaggctgcatattcgtcgagatgctccagggtcagcccctgttt
ccaggggttcgcaacacctttgaacagctggaggagatctgggagatactgggagtccca
acggaggaaacttggcctggagtttcgaagctttaccactaccggccagagtgttttcct
ctcttactccagggttggttatttctcttgtatcctaggctgggatgggagtctggagtt
gaagacctggcagcaagaatgttgaaagtttgcccacgggacaggatctctgcacaagag
gcactcgtccatcacttcttcagttctctgccctctcagctataccagctttctgaccca
caatctgtcttcgtggtccctggggtgaagctgaaaccagaaatatgtgacctgtttgct
ccgtaccagaaggatcatcacccaatcagctctagcaagttttggtga

DBGET integrated database retrieval system