KEGG   Gekko japonicus: 107113557
Entry
107113557         CDS       T04299                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
gja  Gekko japonicus
Brite
KEGG Orthology (KO) [BR:gja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gja01002]
    107113557 (ADAMTS13)
Enzymes [BR:gja01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     107113557 (ADAMTS13)
Peptidases and inhibitors [BR:gja01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   107113557 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin ANAPC4 TSP1_spondin Reprolysin_3 ADAM_spacer1 Reprolysin_4 Reprolysin_5 Reprolysin_2 Peptidase_M10 TSP1_CCN
Other DBs
NCBI-GeneID: 107113557
NCBI-ProteinID: XP_015270392
Position
Un
AA seq 1282 aa
MLALFAEAIAAVGAFILKADELLQVIDSSMKNFKAFSRWLYVGFPSMQGPEPKDHHLKLL
FAQWCPLQLSHHACNSPGTPSRRLLPGSLLAVQTTRGRKLLSRVRKGAESTVKHLELLVV
VGPDVFWFHKEDTERYILTNLNIGAELLRDASLGAQFRVHLIRMIVLTEPEEGISITTNL
TSSVVSVCEWARKVNPENDSDPSHADLVLYVTRVDLELPDGDKQVRGVTQLGGACSSLWN
CIITEDTGFDLGVTMAHEIGHSFGVQHDGEGNQCSGSGHIMGSEGALNSVDLAWSACSRE
QLLAFVSTGQAGCMDDLPDPKDSIPGGKPGLYYGADEQCKIAFGGAAAACTFARHDMDMC
GVLSCHTDAADLASCTRLLVPLLDGTECGVDKWCFKGRCSSLEDLGPIAVVHGHWSSWTP
SVACSRSCGGGVVARRRHCNNPRPAFGGRPCEGEALQAEMCNTQPCLKTQLGFMEEQCAA
TDVKPLSLSLEFPSFYKWTSAANYAKGDLLCKHVCRARGKDFMVSRGEQFIDGTRCVRGV
RGDEEVFALCVAGTCMVLGCDGKMNSGKKMDACRVCGGDNSTCFSVKGSYTEGKAGGYAT
FLVLPRNATTVRVVNRKPLFTHLAVKIQGQYVVAGSGTISLNVTYPSVLEDSRLEYTVFL
TEDNLPSLEEVCMDGPVQEDVEIQVYRRYGEEYGSITSPDIVFSYFQPSEKRASRLGPCS
VTCGEDLITAVSSPSRWKASKPGKCSATCGLGIAPRNLSCIQVSGGLETVVEDALCSVEK
KPLAFVSCMVNVCPLGWHRENDVRPLESSVVPFWPHQNRSQSVSVWSPLAGECPVSCGGG
SVLLRYVCLDFDTKEETEEGYCDQALKPESQVEICNLLPCPPSWFRKQGPCSASCGGGVM
RNVLYCARQTGEKEEEEMLPDTHCEDLPRPEEQEACNLQPCPPRWKVAGLSPCSSSCGLG
VALQTVICIQFSRGREIEVTNTSCLEAEKPLPSIPCIDRMCSYEWRSTEWTECSVSCGSS
IQTREVFCTSPQMGARVNPILCRNSPKPVRVRSCSLGPCLEQGICGRLFLRSTGLINMTG
LQASDCTIAIGRPLGEVVTVQVLESSLNCSTGEMVVFSSRKMWRTGCKRLTLSVINARTN
TLMVRQRLLLPGNGVVLQYSSAAARKKYHQDCDVQLFGPRGEITSPAPLAGVGTEAACRT
FIDVAPRHRIAIHTVHVDLSVQANEAHSRYILIRDVNNMKTSVFSRNQLFYWQSTGNRAE
IEFNKDFADIHFRAEYWIVEPK
NT seq 3849 nt   +upstreamnt  +downstreamnt
atgttggctctctttgcagaagcgattgccgccgtgggcgccttcatcctgaaggcagac
gagctgcttcaagttatagacagcagtatgaaaaacttcaaagctttttcccgatggctc
tatgtgggcttcccctccatgcaaggccctgagccaaaagaccatcatctgaagcttctg
tttgctcagtggtgtccattgcagctttcgcatcatgcctgcaactcccccggcactcct
tctcgccgccttcttcctggcagtttgctggctgtccagaccacaagaggaagaaagctt
ctatcccgagtccggaaaggggctgagtcgactgtaaaacacttggagctgcttgttgtg
gtggggccagatgtcttctggttccataaagaagacacggagaggtacatcctcaccaat
ctgaatattggtgctgaattgctccgagacgcctcgctgggagctcagttcagggttcac
ctgatccgaatgatcgtcctcacagagccggaggaaggcatcagcatcaccaccaacctc
acttcctccgtcgtcagcgtctgtgagtgggccaggaaggtcaaccctgagaacgactcc
gatcccagccatgcggatctcgttctgtatgtgaccagggtcgacctggagttaccagat
ggggacaagcaggtgcggggcgtcacccagctgggtggggcctgttcctccctctggaac
tgcatcatcactgaggacaccgggtttgacctgggagtcacaatggcgcacgagatcgga
cacagcttcggggtccagcacgatggagaagggaaccagtgctctgggagtggacacatt
atgggctctgagggagctctcaacagcgtggatctggcgtggtctgcatgtagcagggag
cagctcctcgcctttgtcagtacaggccaagcaggctgcatggatgacctgccggacccc
aaggacagcatcccaggagggaagcccggcctgtattacggggcggacgagcagtgcaag
atagcctttgggggcgcagccgctgcctgcactttcgccaggcacgacatggatatgtgc
ggagtcctctcttgtcacaccgatgccgccgacctggctagctgtacgcggcttctcgtc
cccctcctggacggaactgaatgcggggtcgacaagtggtgcttcaaaggccgctgcagc
tccctggaagacctgggtcccatcgcagtagtccacgggcactggtccagctggacgcct
tccgtggcctgctcccgcagctgcggaggaggagttgtggctcggagacgacactgcaac
aaccccaggcctgcttttggcggacgtccatgcgagggggaagccttgcaggcggaaatg
tgtaacacgcagccctgtctgaagacccagctgggtttcatggaggaacaatgtgccgca
acggatgtgaagcccctttccctcagcctggagttcccgtccttttacaagtggacttca
gctgccaattatgccaaaggagacctgctgtgcaaacacgtgtgcagggcacgtgggaag
gacttcatggtgagtcgaggggagcagttcatagacggcacaaggtgtgtgcgaggcgtt
cggggagatgaagaggtgttcgccctgtgcgtggcaggcacctgcatggttttggggtgc
gatggcaagatgaattccgggaagaagatggatgcctgcagggtgtgtggtggagacaac
tctacgtgtttcagcgtgaagggctcatacactgaagggaaggccggaggatatgcgacc
tttctggtgcttcctcgtaatgctaccacagtccgtgtggttaaccggaaaccactcttc
actcacttggctgtgaagatccaagggcagtacgtggtggctgggtccggcactatttct
ttgaatgtcacatacccctctgtcctggaggacagccggctagaatacacggtctttctt
acggaggacaacctgcctagcttggaggaagtttgcatggatggaccagtgcaggaggat
gtagagatacaggtttataggaggtacggggaggaatacgggagcatcaccagcccagac
atcgtcttcagctactttcagcccagcgagaaacgggcttcccggctcgggccctgctct
gtgacctgtggggaagaccttataactgctgtttcttccccatccagatggaaggcatcc
aagccgggcaagtgctctgccacctgcggcttaggaattgccccacggaatctttcctgc
atccaggtttctggtggcctggagactgtagtggaggatgctctgtgctcagtggagaag
aagccccttgcttttgtctcttgcatggtgaacgtctgccctttggggtggcacagggag
aacgacgtgcgccccctggagtcttctgtcgtccccttttggccccatcagaaccgcagt
cagtcagtctctgtttggagccctttggctggagaatgcccggtcagctgtggaggaggc
tcagttctgttgcgctatgtctgtctggactttgataccaaagaagaaactgaggaggga
tattgtgaccaggcactgaagccggagagtcaggtggaaatctgtaatcttttgccatgc
ccaccaagctggttccgcaaacagggcccttgcagtgcgagctgcggtggaggtgtgatg
cgtaacgtcctgtactgtgcacggcagacgggggagaaggaggaggaagagatgctgcca
gacacacactgcgaggatttgccccgccccgaggaacaggaagcgtgcaacctgcagccg
tgtcccccaaggtggaaagtggcaggtctcagcccgtgttcctcctcctgcgggcttggg
gtggccctccagactgttatttgcatacagttttctcgaggccgagagattgaagtgaca
aacacctcttgcctggaagcagagaagccccttcccagcatcccctgcatcgaccgcatg
tgctcttacgagtggagatccaccgaatggacagagtgctccgtgtcttgtgggagcagc
atccagacccgggaggttttctgcaccagtccccaaatgggagcgcgagtgaaccccatc
ctgtgcaggaattcccccaagcccgtgagagtgcgcagctgctcccttggcccctgcctg
gaacaaggcatctgtgggaggctgttcctccgttccactgggctgatcaacatgaccggc
ctgcaagccagtgactgcaccattgccattggccgccccttaggagaggtggtcacagtc
caagtgctggagagctccctcaactgcagcacaggagagatggtggtgttttccagccga
aagatgtggcggacaggctgcaagaggttgacgctctccgtcataaacgcccggaccaac
accctgatggtgagacagcgcctcctgctgcctggcaacggagttgtccttcagtacagc
agcgcagcagcaaggaagaaataccaccaagactgtgacgtgcagctctttggtccccga
ggagaaataacgagccctgcaccattggccggcgtgggcacagaagcggcatgcaggacc
ttcattgatgtggctcctcgacaccgcatagccatccacaccgtgcatgtggatctgagc
gtccaggccaacgaagcacactcccgttacatcttgattcgagatgtgaacaacatgaag
acctccgtcttctccagaaaccagctgttttactggcaatcgaccgggaaccgggcagag
attgaatttaacaaagactttgctgatatccatttccgagcagagtactggatcgtggaa
cccaaataa

DBGET integrated database retrieval system