KEGG   Gekko japonicus: 107114012Help
Entry
107114012         CDS       T04299                                 

Gene name
ACSL4
Definition
(RefSeq) acyl-CoA synthetase long-chain family member 4
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
gja  Gekko japonicus
Pathway
gja00061  Fatty acid biosynthesis
gja00071  Fatty acid degradation
gja01100  Metabolic pathways
gja01212  Fatty acid metabolism
gja03320  PPAR signaling pathway
gja04146  Peroxisome
gja04216  Ferroptosis
gja04920  Adipocytokine signaling pathway
Module
gja_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    107114012 (ACSL4)
   00071 Fatty acid degradation
    107114012 (ACSL4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107114012 (ACSL4)
  09143 Cell growth and death
   04216 Ferroptosis
    107114012 (ACSL4)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107114012 (ACSL4)
   03320 PPAR signaling pathway
    107114012 (ACSL4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gja01004]
    107114012 (ACSL4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gja04147]
    107114012 (ACSL4)
Enzymes [BR:gja01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     107114012 (ACSL4)
Lipid biosynthesis proteins [BR:gja01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   107114012 (ACSL4)
Exosome [BR:gja04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   107114012 (ACSL4)
  Exosomal proteins of breast cancer cells
   107114012 (ACSL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 107114012
NCBI-ProteinID: XP_015270915
Position
Un
AA seq 711 aa AA seqDB search
MNLKLELHAIILLPVYLLISLYSALVFIPWYFLTNAKKKKAMAKRLKAKPVSENPGSPYR
AISHLETLATIDFPGADTLDKLFDHAVAKFGKKDCLGTRELLSEENEMQPNGKVFKKLIL
GNYRWLSYEEVNQKVDYFGSGLAAIGLKPKSTVAIFCETRAEWIIAAQTCFRYNFPLVTL
YATLGEEAVTYGLNESGASYLITSTDLLEGKLKNVLQDITCLKHIIYVDKKTINKSDYSE
RLEVHSMQTIEELGARPENISIPPSRPLPTDLALVMYTSGSTGRPKGVMMMHKNLIAGMT
GQCERIPGLGPKDTYIGYLPLAHVLEMTAEISCITYGCRVGYSSPLTLSDQSSKIKKGSK
GDCSVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKRGYDAPLC
NLLLFKKVKALLGGNVRMMLSGGAPLSPQTQRFMNICFCCPVGQGYGLTETCGAGTITEV
TDYSTGRVGAPLVCCEIKLRDWQEGGYTNRDKPNPRGEIIIGGPNVSMGYFRNEEKTAED
FITDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDN
ICAYAKSDQSYVISFVVPNQKKLTDLAEQKGVTGTWVDICNNPIMEAEILKEIKEVANKM
KLERFEIPVKVRLSPEPWTPETGLVTDAFKLKRKELKNHYLNDIERMYGGK
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttaagctagagctccacgccattatcttgctccctgtgtacttattgatatct
ctgtacagtgcccttgtattcataccatggtattttcttaccaatgctaagaagaaaaaa
gctatggcaaagcgcttaaaagctaagcccgtctcggaaaaccctggaagcccataccga
gccatttcccatcttgagacactagccactatagactttcctggagcagacactttggac
aaattgtttgaccatgctgttgcgaagtttgggaaaaaggattgtcttggaacaagagag
ctcctgagtgaagagaatgaaatgcagcccaatgggaaagtatttaaaaagctgatcctg
ggaaactatagatggctaagctatgaagaagtgaaccagaaagtagactactttgggagc
ggattagctgcaataggactgaaaccaaagagcacagttgccatattctgtgaaacccgg
gcagaatggatcattgcagcccagacctgtttccgatacaactttcctctcgttacttta
tacgcaacccttggagaagaggcagtaacctatgggctgaatgaatccggagcatcgtat
ctaatcactagcacagaccttttagaaggcaaacttaagaatgtactgcaagacatcact
tgcctcaaacatatcatttatgttgacaagaagactatcaataagtcagactattctgaa
agactggaggtccatagcatgcagacaatagaagaactcggcgccagacctgagaacata
agcatccctcccagccggcctcttcctacagatctggccctagtaatgtacaccagcggg
tccaccgggaggcccaaaggcgtgatgatgatgcataaaaacctgatagccggaatgacg
ggacagtgtgaacgaatacctggactcggacccaaggacacctacattggctacctgcct
ctagctcacgtcttagaaatgacagcggaaatttcctgtattacttacggctgcagggtc
ggatactcctctccactcacgctctcagaccagtcgagcaaaattaagaagggaagcaaa
ggagactgcagtgtcctgaaacccaccctgatggcagctgtgccggaaatcatggatcga
atttataagaatgtaatgagtaaagttcaagagatgaactatattcaaaagacgttgttc
aagataggttatgattacaaattggagcaaatcaagaggggatacgatgcgccgctctgt
aacttattactgtttaaaaaagtgaaagcactgctgggagggaatgtacgtatgatgctg
tctggaggcgcacccctttcacctcaaacacaaaggttcatgaacatctgtttctgctgc
cctgttggccaaggttacggattaacagaaacctgtggcgcaggaacaattacagaagtt
actgactacagcactggcagagttggagctcctcttgtctgctgtgagattaaactgaga
gactggcaagaaggaggctataccaatagagacaaaccaaaccccagaggtgagattata
attggtggacccaatgtctcaatgggctacttcagaaacgaagagaagacagcagaagac
ttcatcactgatgaaaacggtcaacgatggttctgtaccggggacattggagagtttcat
cctgacggctgcctgcaaatcatagatcgcaaaaaagatttggtgaagctgcaggcagga
gaatacgtatcgctgggcaaggtggaggcagccctgaaaaactgcccgcttattgacaac
atctgtgcttatgccaaaagtgatcagtcttatgtgatcagctttgtggttcccaatcag
aagaaactaaccgatcttgctgaacagaaaggtgtgaccggaacctgggtggacatctgt
aacaatcctatcatggaagctgaaatcctgaaagagattaaggaggtggctaacaaaatg
aagctggagagatttgaaataccagtcaaagtgcggttaagcccagaaccttggacccca
gagaccggcctggtgacagatgctttcaagctgaaacggaaagagctgaagaaccattac
ctcaatgacatcgaacgaatgtacggaggtaaataa

DBGET integrated database retrieval system