KEGG   Gekko japonicus: 107115203Help
Entry
107115203         CDS       T04299                                 

Definition
(RefSeq) transforming growth factor beta-2-like
  KO
K13376  transforming growth factor beta-2
Organism
gja  Gekko japonicus
Pathway
gja04010  MAPK signaling pathway
gja04060  Cytokine-cytokine receptor interaction
gja04068  FoxO signaling pathway
gja04110  Cell cycle
gja04218  Cellular senescence
gja04350  TGF-beta signaling pathway
gja04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:gja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107115203
   04350 TGF-beta signaling pathway
    107115203
   04068 FoxO signaling pathway
    107115203
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107115203
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107115203
   04218 Cellular senescence
    107115203
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107115203
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gja04052]
    107115203
   00536 Glycosaminoglycan binding proteins [BR:gja00536]
    107115203
Cytokines and growth factors [BR:gja04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   107115203
Glycosaminoglycan binding proteins [BR:gja00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107115203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 107115203
NCBI-ProteinID: XP_015272328
Position
Un
AA seq 411 aa AA seqDB search
MLRFPLLWVALVLDLGGTASALSTCQTLDLEVARARRVEAIRGQILSKLQMVAPPEEERG
VPDQPPPEVMLLYNSTRELTRERAACDGRSSSEEEEYYAKEVRRVDMSPPGHADNTIAST
QPSPFFRLLRFDVSGAEPNLSSLIQAELRVYRVPNPRARAGHICDRLYFPQVVQAREPSA
PTQRYVESQTLRPTDRAEWVSFDVTDTVSQWLDKRERNLGLKLGVHCPCCTYIPAGNTIN
PNHSEELEVRFAGLDDDLIKEAWKGRSRPPDLSGKAPHLIFTLLPPHRLEPPPKGRRRRA
ANAPTCTRSTDQGCCLRTLYIDFRKDLKWKWIHQPKGYKANFCAGTCRYVWSTDTQYNMV
LPLYNKLNPEASAAPCCVPHELEPLTILYYVGRSPKVQQLSNMIVKSCRCR
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgctccggttcccgctcctgtgggtcgcgttggttctggacctggggggcacagcctcg
gcgctctccacctgccagactttggacctggaggtggccagggctcggcgggtagaggcc
atacgagggcagatcctcagcaagctgcagatggtggcgcctccggaagaggagcgaggg
gtgcccgaccagccgccccccgaggtgatgctgctgtacaacagcacgcgcgagctgacc
cgagagcgagcggcctgcgacgggcggagcagcagcgaggaagaggagtactacgccaag
gaagtgcggcgggtggacatgtcgccccccgggcacgctgacaacaccatcgcgagcacc
caacccagccccttcttccgcctcctgcgcttcgacgtctcgggagccgagcccaacctg
agcagccttattcaagctgagttacgcgtctaccgggtgccgaacccccgggcacgagct
gggcacatttgtgacaggttatatttcccacaggtggtccaggcacgggagccctctgca
ccaacccagcgttacgtggagagccagacgttgcggccaacagatcgggctgagtgggtg
tcgtttgacgtcactgacacggtcagccagtggctggataaaagagagagaaacctgggc
ctgaaattgggggtgcactgcccttgttgcacttacatccccgctgggaacacaatcaac
cccaaccacagcgaggagctggaggtgcgctttgcaggcctggatgacgatctcatcaag
gaggcctggaaaggacgctcacggcccccagacctcagcggcaaggccccccacctgatc
ttcacgctgctgcccccgcaccgcctggagccccctccaaaggggcgccgccgtcgagca
gccaacgctcctacctgtaccaggagtacagaccagggttgttgcctccgcaccctgtat
attgatttccgcaaagatctgaagtggaaatggatccaccaaccgaaaggctacaaggca
aatttctgcgccgggacctgtcgctacgtatggagcacggacacgcagtacaacatggtg
ctccctttgtacaacaagctgaaccccgaagcctcggccgccccctgctgcgtccctcac
gaactggagcccctgaccatcctctactacgtcggccgctctcccaaagtgcagcagctc
agcaacatgatcgtgaagtcttgccgttgccgctga

DBGET integrated database retrieval system