KEGG   Gekko japonicus: 107115318Help
Entry
107115318         CDS       T04299                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
gja  Gekko japonicus
Pathway
gja00260  Glycine, serine and threonine metabolism
gja01100  Metabolic pathways
gja01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    107115318
Enzymes [BR:gja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     107115318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 107115318
NCBI-ProteinID: XP_015272485
Position
Un
AA seq 484 aa AA seqDB search
MQHELRYSCQGVGACPAPPAYGQPGMGTLLIHKNQYQTFNKAVAHPKSKWQSLSAIPKHS
WLSRIKSRCHSQSVASQHCTLLPWWHLRHTPLAPALRIGAHGYHITSLPAETEHHVVDLR
SDTVTRPSPEMRQAMAQAEVGDDDYGEDPTVNELQSVIADLLGKEEAIFVPTATMANLIA
VMCHCCRRGAQLLLGREAHIHVFEHGGVAQVAGVHSETLQDLPDGTFRLDELEHKIQQSY
GSQYYPRPELICLENTHCSAGGRVLPLQYLQEMHQLAHQYGLKIHLDGARVLNAAVALGV
LPSHITQHCDSVSLCLSKGVGAPAGALLAGRREFIVEAWRVRKLLGGGMRQAGVLAAAAL
VGLRHMEETLRRDHNNARSFAEGVYNLGSPLCSINPATVETNIVMMTTSGSWLAPAKLCE
LMEAVSEEEVATTGQAVSVRLFPWGEHSLRAVWHCDVSAQDTQLAGSKLRFVLDKCEREQ
VQVC
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacgagctccgctattcctgccagggagttggtgcttgccctgctccgcctgca
tatggtcaaccaggtatgggcacccttttgatccataagaaccagtaccagacctttaac
aaggccgtagcccatccgaagtctaaatggcaaagccttagtgccatccctaaacattct
tggctctctagaatcaaatcaaggtgtcacagccaatctgtagccagccaacactgtact
cttctaccctggtggcacctacggcataccccccttgctcctgcactcaggattggtgct
cacggttatcacataacaagtcttcctgcggagactgagcatcatgtggtggatctgcgc
agtgacaccgtgactcggcccagccctgaaatgaggcaagctatggctcaggcggaggtg
ggagatgatgactacggggaggaccccacagtcaatgagcttcagagtgtcattgctgac
ctcctgggaaaggaagaggctatatttgtacccactgccaccatggctaacctcattgct
gttatgtgccactgttgcagacgaggggcgcagcttctacttgggagggaggctcacatc
catgtttttgagcatggaggggttgcacaggtggctggagtccattcagagacattgcag
gacctgccagatgggaccttcaggcttgatgaactggagcataagatccagcagagctac
ggaagtcagtactacccccggcctgagcttatctgccttgagaatacccattgctcagca
gggggacgggtccttccccttcagtacttgcaagagatgcatcagcttgcacaccaatat
gggctgaagatacatctggatggggcccgggtgcttaatgccgcagtggccctgggagtg
ctgccaagtcacatcacccaacactgtgattccgtctccctgtgtctctctaagggtgtg
ggtgcaccagctggagccctgctagctggacggagagaattcattgtcgaggcctggcgt
gtgcggaagcttcttggaggcgggatgcgccaagctggggttctggcagcagctgccctt
gttggattgagacacatggaggaaacactgcggagggatcacaacaatgccagaagcttt
gctgaaggagtctacaaccttgggtctcctctctgctctataaacccagccactgtggag
accaatatcgtcatgatgacaacatcgggctcttggctggctcctgccaaactgtgtgag
ctcatggaggctgtgagtgaagaggaagttgctaccacaggccaagccgttagcgtgcgg
ctcttcccatggggtgagcattccctgcgtgcagtctggcactgtgatgtctctgctcag
gacacgcagttagctggaagcaagttgcgctttgtgctggacaagtgtgagcgggagcag
gtgcaggtctgctga

DBGET integrated database retrieval system